CCL24/Eotaxin-2 Protein, Mouse (HEK293, N-His)
Based on 1 Customer Validation
CCL24/Eotaxin-2 Protein, Mouse (HEK293, N-His) is a CC chemokine that interacts with the chemokine receptor CCR3 to induce eosinophil chemotaxis and mediate atopic diseases, parasitic infections and systemic diseases, as well as promote cellular transport and regulate inflammatory and fibrotic activities. CCL24/Eotaxin-2 Protein, Mouse (HEK293, His) is a recombinant mouse CCL24/Eotaxin-2 (V27-V119) protein expressed by HEK293 with a his tag at the N-terminus.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
CCL24/Eotaxin-2 Protein, Mouse (HEK293, N-His) is a CC chemokine that interacts with the chemokine receptor CCR3 to induce eosinophil chemotaxis and mediate atopic diseases, parasitic infections and systemic diseases, as well as promote cellular transport and regulate inflammatory and fibrotic activities. CCL24/Eotaxin-2 Protein, Mouse (HEK293, His) is a recombinant mouse CCL24/Eotaxin-2 (V27-V119) protein expressed by HEK293 with a his tag at the N-terminus[1].
Background
CCL24, also known as eosinophil chemotactic protein 2 (eotaxin-2) and myeloid progenitor inhibitory factor 2 (MPIF-2), is a small cytokine of the CC chemokine family, located on chromosome 7 in the human genome. CCL24 is highly chemotactic for resting T lymphocytes and eosinophils and has low chemotactic activity for neutrophils, but not for monocytes and activated lymphocytes. By binding to its sole receptor CCR3, of which CCR3, is present mainly on eosinophils, but also on basophils, monocytes, Th2 lymphocytes, epithelial cells and airway smooth muscle. CCL24 mainly mediates atopic diseases, parasitic infections and systemic diseases, but also promotes cellular transport and regulates inflammatory and fibrotic activities[1][2].
In Vivo
CCL24 deficiency leads to reduced dermal thickness and infiltration of immune cells into the bronchoalveolar lavage (BAL) fluid and significantly reduced α-SMA expression in a mouse model of bleomycin (BLM)-induced skin fibrosis[3].
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag N-8*His
-
Accession
Q9JKC0 (V27-V119)
-
Gene ID56221
-
Molecular Construction
-
N-term
-
8*His
-
CCL24 (V27-V119)
Accession # Q9JKC0 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
CCL24; CK-Beta-6; Prev. SCYA24; Small Inducible Cytokine Subfamily A (Cys-Cys), Member 24; Eotaxin-2; Eosinophil Chemotactic Protein 2; MPIF-2; Chemokine (C-C Motif) Ligand 24; MPIF2; Small-Inducible Cytokine A24; Myeloid Progenitor Inhibitory Factor 2; C
-
AA Sequence
VTIPSSCCTSFISKKIPENRVVSYQLANGSICPKAGVIFITKKGHKICTDPKLLWVQRHIQKLDAKKNQPSKGAKAVRTKFAVQRRRGNSTEV
-
Molecular Weight
Approximately 20-30 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 90%, as determined by Bis-Tris PAGE.
Product Properties
Solution
Supplied as a 0.22 μm filtered solution of 20 mM Tris, 500 mM NaCl, pH 7.5.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
