CCR8 Protein, Human (P. pastoris, His, Myc)

CCR8 Protein-VLP, a receptor for CCL1/SCYA1/I-309, may regulate monocyte chemotaxis and thymic cell line apoptosis. It also acts as an alternative coreceptor with CD4 for HIV-1 infection, facilitating viral entry. The interaction with CCL1 highlights its role in mediating cellular responses to this chemokine, implying a regulatory function in immune and inflammatory processes. CCR8 Protein, Human (P. pastoris, His) is the recombinant human-derived CCR8 protein, expressed by P. pastoris , with C-Myc, C-6*His labeled tag.

The CCR8 Protein-VLP acts as a receptor for the chemokine CCL1/SCYA1/I-309, potentially regulating monocyte chemotaxis and thymic cell line apoptosis. It also serves as an alternative coreceptor with CD4 for HIV-1 infection, implicating its involvement in facilitating viral entry and infection. The interaction between CCR8 and CCL1 underscores its role in mediating cellular responses to this chemokine, suggesting a regulatory function in immune and inflammatory processes.

Human

P. pastoris

C-Myc;C-6*His

P51685 (M1-K35)

1237  [NCBI]

Extracellular Domain

MDYTLDLSVTTVTDYYYPDIFSSPCDAELIQTNGK

Approximately 14-25 kDa,based on SDS-PAGE under reducing conditions.

≥ 90%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, 6% trehalose, pH 8.0.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.