CCR8 Protein, Human (P. pastoris, His, Myc)
Based on 1 Customer Validation
CCR8 Protein-VLP, a receptor for CCL1/SCYA1/I-309, may regulate monocyte chemotaxis and thymic cell line apoptosis. It also acts as an alternative coreceptor with CD4 for HIV-1 infection, facilitating viral entry. The interaction with CCL1 highlights its role in mediating cellular responses to this chemokine, implying a regulatory function in immune and inflammatory processes. CCR8 Protein, Human (P. pastoris, His) is the recombinant human-derived CCR8 protein, expressed by P. pastoris , with C-Myc, C-6*His labeled tag.
- Species: Human
- Source: P. pastoris
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
CCR8 Protein-VLP, a receptor for CCL1/SCYA1/I-309, may regulate monocyte chemotaxis and thymic cell line apoptosis. It also acts as an alternative coreceptor with CD4 for HIV-1 infection, facilitating viral entry. The interaction with CCL1 highlights its role in mediating cellular responses to this chemokine, implying a regulatory function in immune and inflammatory processes. CCR8 Protein, Human (P. pastoris, His) is the recombinant human-derived CCR8 protein, expressed by P. pastoris , with C-Myc, C-6*His labeled tag.
Background
The CCR8 Protein-VLP acts as a receptor for the chemokine CCL1/SCYA1/I-309, potentially regulating monocyte chemotaxis and thymic cell line apoptosis. It also serves as an alternative coreceptor with CD4 for HIV-1 infection, implicating its involvement in facilitating viral entry and infection. The interaction between CCR8 and CCL1 underscores its role in mediating cellular responses to this chemokine, suggesting a regulatory function in immune and inflammatory processes.
Technical Parameters
-
Species Human
-
Source P. pastoris
-
Tag C-Myc;C-6*His
-
Accession
P51685 (M1-K35)
-
Molecular Construction
-
N-term
-
CCR8 (M1-K35)
Accession # P51685 -
6*His-Myc
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
CCR8; Chemokine Receptor-Like 1; Prev. CMKBRL2; GPRCY6; Prev. CMKBR8; CCR-8; TER1; CKRL1; C-C Chemokine Receptor Type 8; Chemokine (C-C) Receptor-Like 2; GPR-CY6; CC-Chemokine Receptor Chemr1; CKR-L1; Chemokine (C-C) Receptor 8; CDw198; CC Chemokine Recep
-
AA Sequence
MDYTLDLSVTTVTDYYYPDIFSSPCDAELIQTNGK
-
Predicted Molecular Mass
7.7 kDa
-
Molecular Weight
Approximately 14-25 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, 6% trehalose, pH 8.0.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (232 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
