CD117/c-Kit Protein, Mouse (HEK293, His)
Based on 1 Customer Validation
CD117/c-Kit protein is a tyrosine protein kinase that acts as a cell surface receptor for KITLG/SCF and regulates cell survival, proliferation, hematopoiesis, stem cell maintenance, gametogenesis, mast cell development, migration, function, and melanogenesis .CD117/c-Kit Protein, Mouse (HEK293, His) is the recombinant mouse-derived CD117/c-Kit protein, expressed by HEK293 , with C-10*His labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
CD117/c-Kit protein is a tyrosine protein kinase that acts as a cell surface receptor for KITLG/SCF and regulates cell survival, proliferation, hematopoiesis, stem cell maintenance, gametogenesis, mast cell development, migration, function, and melanogenesis .CD117/c-Kit Protein, Mouse (HEK293, His) is the recombinant mouse-derived CD117/c-Kit protein, expressed by HEK293 , with C-10*His labeled tag.
Background
The CD117/c-Kit protein is a tyrosine-protein kinase that serves as a cell-surface receptor for the cytokine KITLG/SCF. It plays a crucial role in regulating cell survival and proliferation, hematopoiesis, stem cell maintenance, gametogenesis, mast cell development, migration, function, and melanogenesis. Upon binding to KITLG/SCF, CD117/c-Kit activates multiple signaling pathways, including PI3K/AKT, GRB2/RAS/RAF/MAPK, and STAT. This leads to the phosphorylation of various downstream effectors such as PIK3R1, PLCG1, SH2B2/APS, CBL, and transcription factors STAT1, STAT3, STAT5A, and STAT5B. Activation of PLCG1 results in the production of diacylglycerol and inositol 1,4,5-trisphosphate, important cellular signaling molecules. CD117/c-Kit signaling is regulated by protein phosphatases, rapid internalization, and degradation of the receptor. Additionally, it promotes the phosphorylation of PTPN6/SHP-1, PTPRU, and other proteins like CRK, LYN, SRC, and SHC1.
Verified Bioactivity
1.This product does not contain protein kinase domain.
2.Measured by its binding ability in a functional ELISA. When Recombinant Mouse CD117/c-kit Fc Chimera is present at 0.5 μg/mL, can bind BiotinylatedRecombinant Mouse SCF/c-kit Ligand. The ED50 for this effect is 1.57 ng/mL.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
-
Bioactivity - ELISA
Bioactivity - ELISA
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-10*His
-
Accession
P05532-1 (S25-T523)
-
Molecular Construction
-
N-term
-
KIT (S25-T523)
Accession # P05532-1 -
10*His
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
KIT; C-Kit Protooncogene; Prev. PBT; Platelet-Derived Growth Factor Receptor-Like Protein; Mast/Stem Cell Growth Factor Receptor Kit; Mast/Stem Cell Growth Factor Receptor Variant; SCFR; Proto-Oncogene Tyrosine-Protein Kinase Kit; V-Kit Hardy-Zuckerman 4
-
AA Sequence
SQPSASPGEPSPPSIHPAQSELIVEAGDTLSLTCIDPDFVRWTFKTYFNEMVENKKNEWIQEKAEATRTGTYTCSNSNGLTSSIYVFVRDPAKLFLVGLPLFGKEDSDALVRCPLTDPQVSNYSLIECDGKSLPTDLTFVPNPKAGITIKNVKRAYHRLCVRCAAQRDGTWLHSDKFTLKVRAAIKAIPVVSVPETSHLLKKGDTFTVVCTIKDVSTSVNSMWLKMNPQPQHIAQVKHNSWHRGDFNYERQETLTISSARVDDSGVFMCYANNTFGSANVTTTLKVVEKGFINISPVKNTTVFVTDGENVDLVVEYEAYPKPEHQQWIYMNRTSANKGKDYVKSDNKSNIRYVNQLRLTRLKGTEGGTYTFLVSNSDASASVTFNVYVNTKPEILTYDRLINGMLQCVAEGFPEPTIDWYFCTGAEQRCTTPVSPVDVQVQNVSVSPFGKLVVQSSIDSSVFRHNGTVECKASNDVGKSSAFFNFAFKGNNKEQIQAHT
-
Molecular Weight
Approximately 70-80 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (239 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)