CD117/c-Kit Protein, Mouse (HEK293, His)

CD117/c-Kit protein is a tyrosine protein kinase that acts as a cell surface receptor for KITLG/SCF and regulates cell survival, proliferation, hematopoiesis, stem cell maintenance, gametogenesis, mast cell development, migration, function, and melanogenesis .CD117/c-Kit Protein, Mouse (HEK293, His) is the recombinant mouse-derived CD117/c-Kit protein, expressed by HEK293 , with C-10*His labeled tag.

The CD117/c-Kit protein is a tyrosine-protein kinase that serves as a cell-surface receptor for the cytokine KITLG/SCF. It plays a crucial role in regulating cell survival and proliferation, hematopoiesis, stem cell maintenance, gametogenesis, mast cell development, migration, function, and melanogenesis. Upon binding to KITLG/SCF, CD117/c-Kit activates multiple signaling pathways, including PI3K/AKT, GRB2/RAS/RAF/MAPK, and STAT. This leads to the phosphorylation of various downstream effectors such as PIK3R1, PLCG1, SH2B2/APS, CBL, and transcription factors STAT1, STAT3, STAT5A, and STAT5B. Activation of PLCG1 results in the production of diacylglycerol and inositol 1,4,5-trisphosphate, important cellular signaling molecules. CD117/c-Kit signaling is regulated by protein phosphatases, rapid internalization, and degradation of the receptor. Additionally, it promotes the phosphorylation of PTPN6/SHP-1, PTPRU, and other proteins like CRK, LYN, SRC, and SHC1.

1.This product does not contain protein kinase domain.
2.Measured by its binding ability in a functional ELISA. When Recombinant Mouse CD117/c-kit Fc Chimera is present at 0.5 μg/mL, can bind BiotinylatedRecombinant Mouse SCF/c-kit Ligand. The ED₅₀ for this effect is 1.57 ng/mL.

• 
  Measured by its binding ability in a functional ELISA. When Recombinant Mouse CD117/c-kit Fc Chimera is present at 0.5 μg/mL, can bind Biotinylated Recombinant Mouse SCF/c-kit Ligand. The ED₅₀ for this effect is 1.57 ng/mL.

Mouse

HEK293

C-10*His

P05532-1 (S25-T523)

16590  [NCBI]

Extracellular Domain

SQPSASPGEPSPPSIHPAQSELIVEAGDTLSLTCIDPDFVRWTFKTYFNEMVENKKNEWIQEKAEATRTGTYTCSNSNGLTSSIYVFVRDPAKLFLVGLPLFGKEDSDALVRCPLTDPQVSNYSLIECDGKSLPTDLTFVPNPKAGITIKNVKRAYHRLCVRCAAQRDGTWLHSDKFTLKVRAAIKAIPVVSVPETSHLLKKGDTFTVVCTIKDVSTSVNSMWLKMNPQPQHIAQVKHNSWHRGDFNYERQETLTISSARVDDSGVFMCYANNTFGSANVTTTLKVVEKGFINISPVKNTTVFVTDGENVDLVVEYEAYPKPEHQQWIYMNRTSANKGKDYVKSDNKSNIRYVNQLRLTRLKGTEGGTYTFLVSNSDASASVTFNVYVNTKPEILTYDRLINGMLQCVAEGFPEPTIDWYFCTGAEQRCTTPVSPVDVQVQNVSVSPFGKLVVQSSIDSSVFRHNGTVECKASNDVGKSSAFFNFAFKGNNKEQIQAHT

70-80 kDa

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.