Copy Link Print Information

CD117/c-Kit Protein, Mouse (HEK293, His)

Customer Review

Based on 1 Customer Validation

CD117/c-Kit protein is a tyrosine protein kinase that acts as a cell surface receptor for KITLG/SCF and regulates cell survival, proliferation, hematopoiesis, stem cell maintenance, gametogenesis, mast cell development, migration, function, and melanogenesis .CD117/c-Kit Protein, Mouse (HEK293, His) is the recombinant mouse-derived CD117/c-Kit protein, expressed by HEK293 , with C-10*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for CD117/c-Kit Protein, Mouse (HEK293, His)
  • Experimental Validation Results for CD117/c-Kit Protein, Mouse (HEK293, His)
  • CD117/c-Kit Protein, Mouse (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

CD117/c-Kit protein is a tyrosine protein kinase that acts as a cell surface receptor for KITLG/SCF and regulates cell survival, proliferation, hematopoiesis, stem cell maintenance, gametogenesis, mast cell development, migration, function, and melanogenesis .CD117/c-Kit Protein, Mouse (HEK293, His) is the recombinant mouse-derived CD117/c-Kit protein, expressed by HEK293 , with C-10*His labeled tag.

Background

The CD117/c-Kit protein is a tyrosine-protein kinase that serves as a cell-surface receptor for the cytokine KITLG/SCF. It plays a crucial role in regulating cell survival and proliferation, hematopoiesis, stem cell maintenance, gametogenesis, mast cell development, migration, function, and melanogenesis. Upon binding to KITLG/SCF, CD117/c-Kit activates multiple signaling pathways, including PI3K/AKT, GRB2/RAS/RAF/MAPK, and STAT. This leads to the phosphorylation of various downstream effectors such as PIK3R1, PLCG1, SH2B2/APS, CBL, and transcription factors STAT1, STAT3, STAT5A, and STAT5B. Activation of PLCG1 results in the production of diacylglycerol and inositol 1,4,5-trisphosphate, important cellular signaling molecules. CD117/c-Kit signaling is regulated by protein phosphatases, rapid internalization, and degradation of the receptor. Additionally, it promotes the phosphorylation of PTPN6/SHP-1, PTPRU, and other proteins like CRK, LYN, SRC, and SHC1.

Verified Bioactivity

1.This product does not contain protein kinase domain.
2.Measured by its binding ability in a functional ELISA. When Recombinant Mouse CD117/c-kit Fc Chimera is present at 0.5 μg/mL, can bind BiotinylatedRecombinant Mouse SCF/c-kit Ligand. The ED50 for this effect is 1.57 ng/mL.

Technical Parameters

  • Species Mouse
  • Source HEK293
  • Tag C-10*His
  • Accession

    P05532-1 (S25-T523)

  • Gene ID
    16590  [NCBI]
  • Molecular Construction
    • N-term
    • KIT (S25-T523)
      Accession # P05532-1
    • 10*His
    • C-term
  • Protein Length

    Extracellular Domain

  • Synonyms

    KIT; C-Kit Protooncogene; Prev. PBT; Platelet-Derived Growth Factor Receptor-Like Protein; Mast/Stem Cell Growth Factor Receptor Kit; Mast/Stem Cell Growth Factor Receptor Variant; SCFR; Proto-Oncogene Tyrosine-Protein Kinase Kit; V-Kit Hardy-Zuckerman 4

  • AA Sequence

    SQPSASPGEPSPPSIHPAQSELIVEAGDTLSLTCIDPDFVRWTFKTYFNEMVENKKNEWIQEKAEATRTGTYTCSNSNGLTSSIYVFVRDPAKLFLVGLPLFGKEDSDALVRCPLTDPQVSNYSLIECDGKSLPTDLTFVPNPKAGITIKNVKRAYHRLCVRCAAQRDGTWLHSDKFTLKVRAAIKAIPVVSVPETSHLLKKGDTFTVVCTIKDVSTSVNSMWLKMNPQPQHIAQVKHNSWHRGDFNYERQETLTISSARVDDSGVFMCYANNTFGSANVTTTLKVVEKGFINISPVKNTTVFVTDGENVDLVVEYEAYPKPEHQQWIYMNRTSANKGKDYVKSDNKSNIRYVNQLRLTRLKGTEGGTYTFLVSNSDASASVTFNVYVNTKPEILTYDRLINGMLQCVAEGFPEPTIDWYFCTGAEQRCTTPVSPVDVQVQNVSVSPFGKLVVQSSIDSSVFRHNGTVECKASNDVGKSSAFFNFAFKGNNKEQIQAHT

  • Molecular Weight

    Approximately 70-80 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured by its binding ability in a functional ELISA. When Recombinant Mouse CD117/c-kit Fc Chimera is present at 0.5 μg/mL, can bind Biotinylated Recombinant Mouse SCF/c-kit Ligand. The ED50 for this effect is 1.57 ng/mL.

  • CD117/c-Kit Protein, Mouse (HEK293, His) Product Image
    1/16
  • Experimental Validation Results for CD117/c-Kit Protein, Mouse (HEK293, His)
  • Experimental Validation Results for CD117/c-Kit Protein, Mouse (HEK293, His)
  • CD117/c-Kit Protein, Mouse (HEK293, His) Product Image