CD160 Protein, Human (HEK293, Fc)

CD160 Protein, Human (HEK293, Fc) is a recombinant human CD160 expressed in HEK 293 cells with a C-Fc tag at the C-terminus. CD160 Protein binds weakly to MHC I and stimulates NK and CD8⁺ T‐cell activation^[1][2].

CD160, a 27 kDa glycoprotein, is a member of the immunoglobulin 'superfamily' of proteins. CD160 was initially identified with the monoclonal antibody BY55. CD160 is reported to be expressed by NK cells, NKT cells, intraepithelial T cells, γδ TCR⁺ T cells, and memory-phenotype, activated and effector CD8⁺ T cells. CD160 binds weakly to MHC I and stimulates NK and CD8⁺ T‐cell activation. CD160 also can act as a marker for cytolytic or exhausted CD8⁺ T cells^[1][2].

Human

HEK293

C-Fc

O95971-1 (I27-S159)

11126  [NCBI]

Partial

INITSSASQEGTRLNLICTVWHKKEEAEGFVVFLCKDRSGDCSPETSLKQLRLKRDPGIDGVGEISSQLMFTISQVTPLHSGTYQCCARSQKSGIRLQGHFFSILFTETGNYTVTGLKQRQHLEFSHNEGTLS

Approximately 50-60 kDa,based on SDS-PAGE under reducing conditions.

≥ 95%, as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.

• [1]. Cai G, et, al. The CD160, BTLA, LIGHT/HVEM pathway: a bidirectional switch regulating T-cell activation. Immunol Rev. 2009 May;229(1):244-58.  [Content Brief]

  [2]. Kaye J. CD160 and BTLA: LIGHTs out for CD4+ T cells. Nat Immunol. 2008 Feb;9(2):122-4.  [Content Brief]