CD276/B7-H3 Protein, Rat (HEK293, His)
Based on 1 Customer Validation
CD276/B7-H3 Protein regulates T-cell-mediated immune responses and transplant rejection. It also promotes bone formation, functioning at the bone-immune interface. Additionally, it activates immune responses against tumors, eliminating them through natural killer cells and CD8 T-cells. Its interaction with TREML2 enhances T-cell activation, highlighting its role in immune regulation. CD276/B7-H3 Protein, Rat (HEK293, His) is the recombinant rat-derived CD276/B7-H3 protein, expressed by HEK293 , with C-His labeled tag.
- Species: Rat
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
CD276/B7-H3 Protein regulates T-cell-mediated immune responses and transplant rejection. It also promotes bone formation, functioning at the bone-immune interface. Additionally, it activates immune responses against tumors, eliminating them through natural killer cells and CD8 T-cells. Its interaction with TREML2 enhances T-cell activation, highlighting its role in immune regulation. CD276/B7-H3 Protein, Rat (HEK293, His) is the recombinant rat-derived CD276/B7-H3 protein, expressed by HEK293 , with C-His labeled tag.
Background
CD276/B7-H3, a multifaceted protein, exerts regulatory influence over T-cell-mediated immune responses and the progression of acute and chronic transplant rejection. Beyond its immunomodulatory role, it may contribute positively to bone formation, demonstrating a dual function at the bone-immune interface. Moreover, CD276 emerges as a key player in antitumor immunity by activating both acquired and innate immune responses, resulting in the elimination of tumor cells through natural killer cell and CD8 T-cell-dependent mechanisms. Notably, its interaction with TREML2 enhances T-cell activation, further underscoring its intricate involvement in immune regulation.
Verified Bioactivity
Measured by its binding ability in a functional ELISA. Immobilized Rat B7-H3, at 2μg/mL (100μL/well) can bind Anti-B7-H3 antibody. The ED50 for this effect is 17.7 ng/mL.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
-
Bioactivity - ELISA
Bioactivity - ELISA
Technical Parameters
-
Species Rat
-
Source HEK293
-
Tag C-6*His
-
Accession
Q7TPB4 (V29-F244)
-
Molecular Construction
-
N-term
-
CD276 (V29-F244)
Accession # Q7TPB4 -
His
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
CD276; Costimulatory Molecule; CD276 Molecule; B7 Homolog 3; CD276 Antigen; B7RP-2; B7-H3; 4Ig-B7-H3; B7H3
-
AA Sequence
VEVQVSEDPVVALVDTDATLRCSFSPEPGFSLRQLNLIWQLTDTKQLVHSFTEGRDQGSAYANRTALFPDLLVQGNASLRLQRVRVTDEGSYTCFVSIQDFDSAAVSLQVAAPYSKPSMTLEPNKDLRPGDMVTITCSSYQGYPEAEVFWKDGQGLPLTGNVTTSQMANERGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSVTITGQPMTF
-
Molecular Weight
Approximately 43 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
