CD276/B7-H3 Protein, Rat (HEK293, His)

Customer Review

Based on 1 Customer Validation

CD276/B7-H3 Protein regulates T-cell-mediated immune responses and transplant rejection. It also promotes bone formation, functioning at the bone-immune interface. Additionally, it activates immune responses against tumors, eliminating them through natural killer cells and CD8 T-cells. Its interaction with TREML2 enhances T-cell activation, highlighting its role in immune regulation. CD276/B7-H3 Protein, Rat (HEK293, His) is the recombinant rat-derived CD276/B7-H3 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Rat
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

CD276/B7-H3 Protein regulates T-cell-mediated immune responses and transplant rejection. It also promotes bone formation, functioning at the bone-immune interface. Additionally, it activates immune responses against tumors, eliminating them through natural killer cells and CD8 T-cells. Its interaction with TREML2 enhances T-cell activation, highlighting its role in immune regulation. CD276/B7-H3 Protein, Rat (HEK293, His) is the recombinant rat-derived CD276/B7-H3 protein, expressed by HEK293 , with C-His labeled tag.

Background

CD276/B7-H3, a multifaceted protein, exerts regulatory influence over T-cell-mediated immune responses and the progression of acute and chronic transplant rejection. Beyond its immunomodulatory role, it may contribute positively to bone formation, demonstrating a dual function at the bone-immune interface. Moreover, CD276 emerges as a key player in antitumor immunity by activating both acquired and innate immune responses, resulting in the elimination of tumor cells through natural killer cell and CD8 T-cell-dependent mechanisms. Notably, its interaction with TREML2 enhances T-cell activation, further underscoring its intricate involvement in immune regulation.

Verified Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized Rat B7-H3, at 2μg/mL (100μL/well) can bind Anti-B7-H3 antibody. The ED50 for this effect is 17.7 ng/mL.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - ELISA

    Bioactivity - ELISA

    Measured by its binding ability in a functional ELISA. Immobilized Rat B7-H3, at 2 μg/mL (100 μL/well) can bind Anti-B7-H3 antibody. The ED50 for this effect is 17.7 ng/mL.

Technical Parameters

  • Species Rat
  • Source HEK293
  • Tag C-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • CD276 (V29-F244)
      Accession # Q7TPB4
    • His
    • C-term
  • Protein Length

    Extracellular Domain

  • Synonyms

    CD276; Costimulatory Molecule; CD276 Molecule; B7 Homolog 3; CD276 Antigen; B7RP-2; B7-H3; 4Ig-B7-H3; B7H3

  • AA Sequence

    VEVQVSEDPVVALVDTDATLRCSFSPEPGFSLRQLNLIWQLTDTKQLVHSFTEGRDQGSAYANRTALFPDLLVQGNASLRLQRVRVTDEGSYTCFVSIQDFDSAAVSLQVAAPYSKPSMTLEPNKDLRPGDMVTITCSSYQGYPEAEVFWKDGQGLPLTGNVTTSQMANERGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSVTITGQPMTF

  • Molecular Weight

    Approximately 43 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00