CD276/B7-H3 Protein, Rat (HEK293, His)

CD276/B7-H3 Protein regulates T-cell-mediated immune responses and transplant rejection. It also promotes bone formation, functioning at the bone-immune interface. Additionally, it activates immune responses against tumors, eliminating them through natural killer cells and CD8 T-cells. Its interaction with TREML2 enhances T-cell activation, highlighting its role in immune regulation. CD276/B7-H3 Protein, Rat (HEK293, His) is the recombinant rat-derived CD276/B7-H3 protein, expressed by HEK293 , with C-His labeled tag.

CD276/B7-H3, a multifaceted protein, exerts regulatory influence over T-cell-mediated immune responses and the progression of acute and chronic transplant rejection. Beyond its immunomodulatory role, it may contribute positively to bone formation, demonstrating a dual function at the bone-immune interface. Moreover, CD276 emerges as a key player in antitumor immunity by activating both acquired and innate immune responses, resulting in the elimination of tumor cells through natural killer cell and CD8 T-cell-dependent mechanisms. Notably, its interaction with TREML2 enhances T-cell activation, further underscoring its intricate involvement in immune regulation.

Measured by its binding ability in a functional ELISA. Immobilized Rat B7-H3, at 2μg/mL (100μL/well) can bind Anti-B7-H3 antibody. The ED₅₀ for this effect is 17.7 ng/mL.

• 
  Measured by its binding ability in a functional ELISA. Immobilized Rat B7-H3, at 2 μg/mL (100 μL/well) can bind Anti-B7-H3 antibody. The ED₅₀ for this effect is 17.7 ng/mL.

Rat

HEK293

C-6*His

Q7TPB4 (V29-F244)

315716  [NCBI]

Extracellular Domain

VEVQVSEDPVVALVDTDATLRCSFSPEPGFSLRQLNLIWQLTDTKQLVHSFTEGRDQGSAYANRTALFPDLLVQGNASLRLQRVRVTDEGSYTCFVSIQDFDSAAVSLQVAAPYSKPSMTLEPNKDLRPGDMVTITCSSYQGYPEAEVFWKDGQGLPLTGNVTTSQMANERGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSVTITGQPMTF

Approximately 34-43 kDa due to the glycosylation.

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.