1. Recombinant Proteins
  2. CD Antigens
  3. T Cell CD Proteins NK Cell CD Proteins
  4. CD3g
  5. CD3 gamma Protein, Human (HEK293, Fc)

CD3 gamma is part of the TCR-CD3 complex on T lymphocytes, promoting TCR-mediated signaling and regulating surface expression. APC-induced TCR activation promotes CD3 gamma as well as CD3D, CD3E, and CD3Z signaling through ITAMs. CD3 gamma Protein, Human (HEK293, Fc) is the recombinant human-derived CD3 gamma protein, expressed by HEK293 , with C-hFc labeled tag.

Para uso exclusivo en investigación. No vendemos a pacientes.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Tamaño Precio Stock Cantidad
Muestra gratis   Apply now
Muestra gratis   Apply now
5 μg En stock
10 μg En stock
50 μg En stock
100 μg   Obtener un presupuesto  

* Seleccione Cantidad antes de agregar artículos.

Top Publications Citing Use of Products
  • Actividad biológica

  • Technical Parameters

  • Properties

  • Descripciòn

Descripciòn

CD3 gamma is part of the TCR-CD3 complex on T lymphocytes, promoting TCR-mediated signaling and regulating surface expression. APC-induced TCR activation promotes CD3 gamma as well as CD3D, CD3E, and CD3Z signaling through ITAMs. CD3 gamma Protein, Human (HEK293, Fc) is the recombinant human-derived CD3 gamma protein, expressed by HEK293 , with C-hFc labeled tag.

Background

CD3 gamma, an integral component of the TCR-CD3 complex on the T-lymphocyte cell surface, is pivotal in the adaptive immune response. As antigen-presenting cells (APCs) activate the T-cell receptor (TCR), CD3 gamma, along with other CD3 chains (CD3D, CD3E, and CD3Z), facilitates the transmission of TCR-mediated signals across the cell membrane. With immunoreceptor tyrosine-based activation motifs (ITAMs) in its cytoplasmic domain, CD3 gamma undergoes phosphorylation by Src family protein tyrosine kinases LCK and FYN upon TCR engagement, activating downstream signaling pathways. Beyond its role in signal transduction, CD3 gamma plays a crucial role in dynamically regulating TCR expression at the cell surface. Constitutive TCR cycling relies on the di-leucine-based (diL) receptor-sorting motif present in CD3 gamma. The TCR-CD3 complex comprises CD3D/CD3E and CD3G/CD3E heterodimers, which preferentially associate with TCRalpha and TCRbeta, forming trimers that interact with CD3Z homodimers to complete the hexameric TCR-CD3 complex. Alternatively, TCRalpha and TCRbeta can be replaced by TCRgamma and TCRdelta, showcasing the versatility of CD3 gamma in TCR assembly and functionality.

Actividad biológica

Measured by its binding ability in a functional ELISA. Immobilized Human CD3 gamma at 1 μg/mL (100 μL/Well) can bind biotinylated Human CD3E (HY-P70506). The ED50 for this effect is 4.208 μg/mL.

  • Measured by its binding ability in a functional ELISA. Immobilized Human CD3 gamma at 1 μg/mL (100 μL/Well) can bind biotinylated Human CD3E (HY-P70506). The ED50 for this effect is 4.208 μg/mL.
Species

Human

Source

HEK293

Tag

C-hFc

Accession

P09693 (Q23-S116)

Gene ID

917  [NCBI]

Molecular Construction
N-term
CD3 gamma (Q23-S116)
Accession # P09693
hFc
C-term
Protein Length

Extracellular Domain

Synonyms
CD3G; CD3-GAMMA; IMD17; T3G; TCR gamma
AA Sequence

QSIKGNHLVKVYDYQEDGSVLLTCDAEAKNITWFKDGKMIGFLTEDKKKWNLGSNAKDPRGMYQCKGSQNKSKPLQVYYRMCQNCIELNAATIS

Peso molecular

45-55 kDa

Glycosylation
Yes
Pureza

≥ 95%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCl, 0.15 M NaCl, 6% trehalose, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Envío

Room temperature in continental US; may vary elsewhere.

Documentación

CD3 gamma Protein, Human (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Productos vistos recientemente:

Consulta en línea

Your information is safe with us. * Required Fields.

CD3 gamma Protein, Human (HEK293, Fc)

 

Requested Quantity *

Nombre del solicitante *

 

Saludo

Direcciòn del E-mail *

 

Número de teléfono *

Department

 

Nombre de la Organizaciòn *

City

Provincia

Country or Region *

     

Observaciones

Consulta para venta a granel

Inquiry Information

Nombre del producto:
CD3 gamma Protein, Human (HEK293, Fc)
Cat. No.:
HY-P78753
Cantidad:
MCE Japan Authorized Agent: