CD5 Protein, Human (HEK293, Fc-Avi)

The CD5 protein is a potential receptor that regulates T cell proliferation. Its interactions with CD72/LYB-2 and PTPN6/SHP-1 indicate multifaceted roles in cellular processes, serving as key mediators of T cell responses. CD5 Protein, Human (HEK293, Fc-Avi) is the recombinant human-derived CD5 protein, expressed by HEK293 , with C-Avi, C-hFc labeled tag.

The CD5 Protein presents itself as a potential receptor implicated in the regulation of T-cell proliferation. Its interaction with CD72/LYB-2 and PTPN6/SHP-1 suggests a multifaceted role in modulating cellular processes. Acting as a receptor, this protein may play a pivotal part in orchestrating T-cell responses, mediating crucial interactions with other cellular components. The engagement with CD72/LYB-2 and PTPN6/SHP-1 underscores its involvement in intricate signaling pathways, hinting at its significance in the regulatory networks that govern T-cell behavior. Further exploration of the CD5 Protein's functions could provide valuable insights into the molecular mechanisms underlying T-cell proliferation and immune modulation.

Human

HEK293

C-Avi;C-hFc

P06127 (R25-N371)

921  [NCBI]

Extracellular Domain

RLSWYDPDFQARLTRSNSKCQGQLEVYLKDGWHMVCSQSWGRSSKQWEDPSQASKVCQRLNCGVPLSLGPFLVTYTPQSSIICYGQLGSFSNCSHSRNDMCHSLGLTCLEPQKTTPPTTRPPPTTTPEPTAPPRLQLVAQSGGQHCAGVVEFYSGSLGGTISYEAQDKTQDLENFLCNNLQCGSFLKHLPETEAGRAQDPGEPREHQPLPIQWKIQNSSCTSLEHCFRKIKPQKSGRVLALLCSGFQPKVQSRLVGGSSICEGTVEVRQGAQWAALCDSSSARSSLRWEEVCREQQCGSVNSYRVLDAGDPTSRGLFCPHQKLSQCHELWERNSYCKKVFVTCQDPN

Approximately 75-82 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.

≥ 95%, as determined by Bis-Tris PAGE.

<1 EU/μg, determined by LAL method.