CD63 Protein, Human/Cynomolgus (HEK293, N-His)

4 Cited Publications
Customer Review

Based on 4 publication(s) in Google Scholar

CD63 protein acts as a receptor for TIMP1, activating cell signaling pathways and promoting cell survival. It plays a key role in integrin signaling, leading to activation of AKT, FAK/PTK2, and MAP kinases. CD63 Protein, Human/Cynomolgus (HEK293, N-His) is the recombinant human-derived CD63 protein, expressed by HEK293 , with N-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human; Cynomolgus
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

CD63 protein acts as a receptor for TIMP1, activating cell signaling pathways and promoting cell survival. It plays a key role in integrin signaling, leading to activation of AKT, FAK/PTK2, and MAP kinases. CD63 Protein, Human/Cynomolgus (HEK293, N-His) is the recombinant human-derived CD63 protein, expressed by HEK293 , with N-6*His labeled tag.

Background

The CD63 Protein functions as a cell surface receptor for TIMP1, contributing to the activation of cellular signaling cascades. It plays a pivotal role in the activation of ITGB1 and subsequent integrin signaling, leading to the activation of AKT, FAK/PTK2, and MAP kinases. This multifaceted protein is involved in diverse cellular processes, including promoting cell survival, orchestrating the reorganization of the actin cytoskeleton, enhancing cell adhesion, spreading, and migration through its involvement in AKT and FAK/PTK2 activation. Furthermore, CD63 participates in VEGFA signaling by regulating the internalization of KDR/VEGFR2 and influences intracellular vesicular transport processes. Its indispensable role in the trafficking of the PMEL luminal domain is crucial for the development and maturation of melanocytes. Additionally, CD63 contributes to leukocyte adhesion onto endothelial cells by regulating SELP trafficking. While it may play a role in mast cell degranulation in response to Ms4a2/FceRI stimulation, it appears to be dispensable for degranulation in response to other stimuli. CD63 interacts with TIMP1 and ITGB1, recruiting TIMP1 to ITGB1 complexes, and forms complexes with CD9 and ITGB3. It also interacts with PMEL and KDR/VEGFR2, the latter being essential for recruiting KDR to ITGB1 complexes, further emphasizing its intricate role in cellular processes.

Verified Bioactivity

Measured by its binding ability in a functional ELISA. When Recombinant Human BST-2/Tetherin is immobilized at 2.5 μg/mL (100 μL/well). The ED50 for this effect is 2.134-5.122 μg/mL corresponding to a specific activity is 4.69×10^3 Unit/mg.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - ELISA

    Bioactivity - ELISA

    Measured by its binding ability in a functional ELISA. When Recombinant Human BST-2/Tetherin is immobilized at 2.5 μg/mL (100 μL/well). The ED50 for this effect is 2.134 μg/mL corresponding to a specific activity is 4.69×103 Unit/mg.

Technical Parameters

  • Species Human; Cynomolgus
  • Source HEK293
  • Tag N-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • 6*His
    • CD63 (A103-V203)
      Accession # P08962-1/NP_001253224
    • C-term
  • Protein Length

    Extracellular Domain

  • Synonyms

    CD63; Tetraspanin-30; Prev. MLA1; AD1 Antigen; TSPAN30; Tspan-30; CD63 Antigen; OMA81H; Pltgp40; Limp1; HOP-26; Lysosomal-Associated Membrane Protein 3; ME491; Lysosome Integral Membrane Protein 1; AD1; Melanoma-Associated Antigen MLA1; Ocular Melanoma-As

  • AA Sequence

    AGYVFRDKVMSEFNNNFRQQMENYPKNNHTASILDRMQADFKCCGAANYTDWEKIPSMSKNRVPDSCCINVTVGCGINFNEKAIHKEGCVEKIGGWLRKNV

  • Molecular Weight

    Approximately 15-25 kDa, based on SDS-PAGE under reducing conditions.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
2.Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.
Please refer to the lot-specific COA for specific buffer information.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00