CD63 Protein, Human/Cynomolgus (HEK293, N-His)
Based on 4 publication(s) in Google Scholar
CD63 protein acts as a receptor for TIMP1, activating cell signaling pathways and promoting cell survival. It plays a key role in integrin signaling, leading to activation of AKT, FAK/PTK2, and MAP kinases. CD63 Protein, Human/Cynomolgus (HEK293, N-His) is the recombinant human-derived CD63 protein, expressed by HEK293 , with N-6*His labeled tag.
- Species: Human; Cynomolgus
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
CD63 protein acts as a receptor for TIMP1, activating cell signaling pathways and promoting cell survival. It plays a key role in integrin signaling, leading to activation of AKT, FAK/PTK2, and MAP kinases. CD63 Protein, Human/Cynomolgus (HEK293, N-His) is the recombinant human-derived CD63 protein, expressed by HEK293 , with N-6*His labeled tag.
Background
The CD63 Protein functions as a cell surface receptor for TIMP1, contributing to the activation of cellular signaling cascades. It plays a pivotal role in the activation of ITGB1 and subsequent integrin signaling, leading to the activation of AKT, FAK/PTK2, and MAP kinases. This multifaceted protein is involved in diverse cellular processes, including promoting cell survival, orchestrating the reorganization of the actin cytoskeleton, enhancing cell adhesion, spreading, and migration through its involvement in AKT and FAK/PTK2 activation. Furthermore, CD63 participates in VEGFA signaling by regulating the internalization of KDR/VEGFR2 and influences intracellular vesicular transport processes. Its indispensable role in the trafficking of the PMEL luminal domain is crucial for the development and maturation of melanocytes. Additionally, CD63 contributes to leukocyte adhesion onto endothelial cells by regulating SELP trafficking. While it may play a role in mast cell degranulation in response to Ms4a2/FceRI stimulation, it appears to be dispensable for degranulation in response to other stimuli. CD63 interacts with TIMP1 and ITGB1, recruiting TIMP1 to ITGB1 complexes, and forms complexes with CD9 and ITGB3. It also interacts with PMEL and KDR/VEGFR2, the latter being essential for recruiting KDR to ITGB1 complexes, further emphasizing its intricate role in cellular processes.
Verified Bioactivity
Measured by its binding ability in a functional ELISA. When Recombinant Human BST-2/Tetherin is immobilized at 2.5 μg/mL (100 μL/well). The ED50 for this effect is 2.134-5.122 μg/mL corresponding to a specific activity is 4.69×10^3 Unit/mg.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
-
Bioactivity - ELISA
Bioactivity - ELISA
Publications (4)
-
Journal Impact Factor
-
Most Recent
-
ACS Nano
Electric Field-Resistant Bubble-Enhanced Wash-Free Profiling of Extracellular Vesicle Surface Markers. [Abstract]2025 Mar 4;19(8):8093-8107. PMID: 39985473 -
-
-
Technical Parameters
-
Species Human; Cynomolgus
-
Source HEK293
-
Tag N-6*His
-
Accession
P08962-1/NP_001253224 (A103-V203)
-
Molecular Construction
-
N-term
-
6*His
-
CD63 (A103-V203)
Accession # P08962-1/NP_001253224 -
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
CD63; Tetraspanin-30; Prev. MLA1; AD1 Antigen; TSPAN30; Tspan-30; CD63 Antigen; OMA81H; Pltgp40; Limp1; HOP-26; Lysosomal-Associated Membrane Protein 3; ME491; Lysosome Integral Membrane Protein 1; AD1; Melanoma-Associated Antigen MLA1; Ocular Melanoma-As
-
AA Sequence
AGYVFRDKVMSEFNNNFRQQMENYPKNNHTASILDRMQADFKCCGAANYTDWEKIPSMSKNRVPDSCCINVTVGCGINFNEKAIHKEGCVEKIGGWLRKNV
-
Molecular Weight
Approximately 15-25 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
1.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
2.Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.
Please refer to the lot-specific COA for specific buffer information.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (237 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)