CHRM2 Protein, Human (His)
CHRM2 Protein, Human (His) is the recombinant human-derived CHRM2, expressed by E. coli , with N-6*His labeled tag.
- Species: Human
- Source: E. coli
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
CHRM2 Protein, Human (His) is the recombinant human-derived CHRM2, expressed by E. coli , with N-6*His labeled tag.
M2R is a muscarinic acetylcholine receptor that mediates various cellular responses through the action of G proteins, including inhibition of adenylate cyclase, breakdown of phosphoinositides, and modulation of potassium channels. Its primary transducing effect is adenylate cyclase inhibition. Signaling by this receptor promotes phospholipase C activity, leading to the release of inositol trisphosphate (IP3), which then triggers calcium ion release into the cytosol. by similar: The receptor's signaling pathway involves the regulation of multiple secondary messengers and ion channels.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-6*His
-
Accession
P08172 (S210-R387)
-
Gene ID1129
-
Protein Length
Cytoplasmic Domain
-
Synonyms
CHRM2; M2 Muscarinic Acetylcholine Receptor; Cholinergic Receptor Muscarinic 2; Muscarinic Acetylcholine Receptor; Acetylcholine Receptor, Muscarinic 2; 7TM Receptor; Muscarinic Acetylcholine Receptor M2; HM2; Muscarinic M2 Receptor
-
AA Sequence
SRASKSRIKKDKKEPVANQDPVSPSLVQGRIVKPNNNNMPSSDDGLEHNKIQNGKAPRDPVTENCVQGEEKESSNDSTSVSAVASNMRDDEITQDENTVSTSLGHSKDENSKQTCIRIGTKTPKSDSCTPTNTTVEVVGSSGQNGDEKQNIVARKIVKMTKQPAKKKPPPSREKKVTR
-
Predicted Molecular Mass
23.4 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
