Claudin-18/CLDN18.1 Protein, Human (His)

Customer Review

Based on 1 Customer Validation

CLDN18 play a crucial role in alveolar fluid homeostasis by modulating tight junction composition, affecting ion transport and solute permeability. They contribute to alveolarization and the paracellular epithelial barrier, affecting epithelial progenitor cell proliferation and organ size by controlling YAP1 subcellular localization. Claudin-18/CLDN18.1 Protein, Human (His) is the recombinant human-derived Claudin-18/CLDN18.1 protein, expressed by E. coli , with N-8*His labeled tag. The complete sequence length is 171 amino acids. In addition to the target fragment P56856-1 (D28-L76), there are other fusion sequences that play a role in stabilizing the extracellular region.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

CLDN18 play a crucial role in alveolar fluid homeostasis by modulating tight junction composition, affecting ion transport and solute permeability. They contribute to alveolarization and the paracellular epithelial barrier, affecting epithelial progenitor cell proliferation and organ size by controlling YAP1 subcellular localization. Claudin-18/CLDN18.1 Protein, Human (His) is the recombinant human-derived Claudin-18/CLDN18.1 protein, expressed by E. coli , with N-8*His labeled tag. The complete sequence length is 171 amino acids. In addition to the target fragment P56856-1 (D28-L76), there are other fusion sequences that play a role in stabilizing the extracellular region.

Background

CLDN18 play a crucial role in alveolar fluid homeostasis by regulating the composition of tight junctions in alveolar epithelial cells, impacting ion transport, and solute permeability, potentially through the modulation of actin cytoskeleton organization and beta-2-adrenergic signaling. Essential for lung alveolarization and the maintenance of the paracellular alveolar epithelial barrier, CLDN18 contribute to epithelial progenitor cell proliferation and organ size regulation by controlling the subcellular localization of YAP1 and restricting its target gene transcription. Additionally, CLDN18 act as a negative regulator of RANKL-induced osteoclast differentiation, possibly by influencing the subcellular distribution of TJP2/ZO-2 and participating in bone resorption in response to calcium deficiency. They mediate the osteoprotective effects of estrogen independently of RANKL signaling pathways. Furthermore, CLDN18 are implicated in maintaining the alveolar microenvironment homeostasis by regulating pH and subsequent T-cell activation, indirectly contributing to the limitation of C. neoformans infection.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag N-8*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • 8*His
    • CLDN18 (D28-L76)
      Accession # P56856-1
    • C-term
  • Protein Length

    Extracellular Domain

  • Synonyms

    CLDN18; Surfactant, Pulmonary Associated Protein J; Prev. SFTPJ; Claudin; Surfactant Associated Protein J; SFTA5; Claudin-18; Claudin 18; Surfactant Associated 5

  • AA Sequence

    DMWSTQDLYDNPVTSVFQYEGLWRSCVRQSSGFTECRPYFTILGLPAML

  • Predicted Molecular Mass

    19.8 kDa

  • Molecular Weight

    Approximately 18 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Formulation

Supplied as a 0.22 μm filtered solution of 20 mM Tris-HCl, 8% Sucrose, 2% Glycine, 20% Glycerol, 5mM DTT, 0.05% Tween 80, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00