1. Recombinant Proteins
  2. CAR-T Related Proteins CD Antigens
  3. Macrophage CD Proteins Monocyte CD Proteins Dendritic Cell CD Proteins
  4. CD319/SLAMF7
  5. CRACC/SLAMF7 Protein, Mouse (HEK293, His)

The CRACC/SLAMF7 protein is an autoligand receptor in the SLAM family that critically regulates immune cell activation and differentiation through homotypic or heterotypic interactions. It coordinates distinct immune responses, dependent on the presence or absence of the cytoplasmic linkers SH2D1A/SAP and/or SH2D1B/EAT-2. CRACC/SLAMF7 Protein, Mouse (HEK293, His) is the recombinant mouse-derived CRACC/SLAMF7 protein, expressed by HEK293 , with C-6*His labeled tag.

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

사이즈 가격 재고 수량
10 μg 해외재고보유
50 μg 해외재고보유
100 μg   견적 받기  

* 장바구니에 담기 전 물품의 수량을 선택해 주십시오.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • 제품 설명

제품 설명

The CRACC/SLAMF7 protein is an autoligand receptor in the SLAM family that critically regulates immune cell activation and differentiation through homotypic or heterotypic interactions. It coordinates distinct immune responses, dependent on the presence or absence of the cytoplasmic linkers SH2D1A/SAP and/or SH2D1B/EAT-2. CRACC/SLAMF7 Protein, Mouse (HEK293, His) is the recombinant mouse-derived CRACC/SLAMF7 protein, expressed by HEK293 , with C-6*His labeled tag.

Background

The CRACC/SLAMF7 protein functions as a self-ligand receptor within the signaling lymphocytic activation molecule (SLAM) family. Through homo- or heterotypic cell-cell interactions, SLAM receptors modulate the activation and differentiation of a diverse array of immune cells, playing a crucial role in the regulation and coordination of both innate and adaptive immune responses. The activities of CRACC/SLAMF7 are intricately controlled by the presence or absence of small cytoplasmic adapter proteins, SH2D1A/SAP, and/or SH2D1B/EAT-2. The protein mediates natural killer (NK) cell activation through a SH2D1A-independent extracellular signal-regulated ERK-mediated pathway and positively regulates NK cell functions in a mechanism dependent on the adapter SH2D1B. Additionally, homotypic interactions between NK cells may contribute to activation, but in the absence of SH2D1B, CRACC/SLAMF7 inhibits NK cell function. It also exerts inhibitory effects in T-cells and may play a role in lymphocyte adhesion. In LPS-activated monocytes, CRACC/SLAMF7 negatively regulates the production of pro-inflammatory cytokines. The protein further interacts with various signaling molecules, including SH2D1B, PTPN6/SHP-1, PTPN11/SHP-2, INPP5D/SHIP1, CSK, and FYN, highlighting its involvement in diverse cellular processes and molecular interactions.

Species

Mouse

Source

HEK293

Tag

C-6*His

Accession

Q8BHK6-1 (S23-G224)

Gene ID
Molecular Construction
N-term
CRACC (S23-G224)
Accession # Q8BHK6-1
6*His
C-term
Protein Length

Extracellular Domain

Synonyms
SLAM Family Member 7; CD2 Subset 1; CRACC; CD319; SLAMF7; CS1
AA Sequence

SGTLKKVAGALDGSVTFTLNITEIKVDYVVWTFNTFFLAMVKKDGVTSQSSNKERIVFPDGLYSMKLSQLKKNDSGAYRAEIYSTSSQASLIQEYVLHVYKHLSRPKVTIDRQSNKNGTCVINLTCSTDQDGENVTYSWKAVGQGDNQFHDGATLSIAWRSGEKDQALTCMARNPVSNSFSTPVFPQKLCEDAATDLTSLRG

분자량

Approximately 30-42 kDa, based on SDS-PAGE under reducing conditions.

Glycosylation
Yes
Purity

≥ 95%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

선적

Room temperature in continental US; may vary elsewhere.

각종 서류
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

최근 본 상품:

온라인 문의

Your information is safe with us. * Required Fields.

CRACC/SLAMF7 Protein, Mouse (HEK293, His)

 

Requested Quantity *

고객명 *

 

호칭

메일주소 *

 

전화번호 *

Department

 

회사명 *

City

Country or Region *

     

비고

대량구매 문의

Inquiry Information

상품명:
CRACC/SLAMF7 Protein, Mouse (HEK293, His)
Cat. No.:
HY-P72461
수량:
MCE Japan Authorized Agent: