CRACC/SLAMF7 Protein, Mouse (HEK293, His)
Based on 1 Customer Validation
The CRACC/SLAMF7 protein is an autoligand receptor in the SLAM family that critically regulates immune cell activation and differentiation through homotypic or heterotypic interactions. It coordinates distinct immune responses, dependent on the presence or absence of the cytoplasmic linkers SH2D1A/SAP and/or SH2D1B/EAT-2. CRACC/SLAMF7 Protein, Mouse (HEK293, His) is the recombinant mouse-derived CRACC/SLAMF7 protein, expressed by HEK293 , with C-6*His labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
The CRACC/SLAMF7 protein is an autoligand receptor in the SLAM family that critically regulates immune cell activation and differentiation through homotypic or heterotypic interactions. It coordinates distinct immune responses, dependent on the presence or absence of the cytoplasmic linkers SH2D1A/SAP and/or SH2D1B/EAT-2. CRACC/SLAMF7 Protein, Mouse (HEK293, His) is the recombinant mouse-derived CRACC/SLAMF7 protein, expressed by HEK293 , with C-6*His labeled tag.
Background
The CRACC/SLAMF7 protein functions as a self-ligand receptor within the signaling lymphocytic activation molecule (SLAM) family. Through homo- or heterotypic cell-cell interactions, SLAM receptors modulate the activation and differentiation of a diverse array of immune cells, playing a crucial role in the regulation and coordination of both innate and adaptive immune responses. The activities of CRACC/SLAMF7 are intricately controlled by the presence or absence of small cytoplasmic adapter proteins, SH2D1A/SAP, and/or SH2D1B/EAT-2. The protein mediates natural killer (NK) cell activation through a SH2D1A-independent extracellular signal-regulated ERK-mediated pathway and positively regulates NK cell functions in a mechanism dependent on the adapter SH2D1B. Additionally, homotypic interactions between NK cells may contribute to activation, but in the absence of SH2D1B, CRACC/SLAMF7 inhibits NK cell function. It also exerts inhibitory effects in T-cells and may play a role in lymphocyte adhesion. In LPS-activated monocytes, CRACC/SLAMF7 negatively regulates the production of pro-inflammatory cytokines. The protein further interacts with various signaling molecules, including SH2D1B, PTPN6/SHP-1, PTPN11/SHP-2, INPP5D/SHIP1, CSK, and FYN, highlighting its involvement in diverse cellular processes and molecular interactions.
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-6*His
-
Accession
Q8BHK6-1 (S23-G224)
-
Molecular Construction
-
N-term
-
CRACC (S23-G224)
Accession # Q8BHK6-1 -
6*His
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
SLAMF7; Protein 19A; SLAM Family Member 7; Novel LY9 (Lymphocyte Antigen 9) Like Protein; CRACC; CD2-Like Receptor Activating Cytotoxic Cells; CS1; CD2-Like Receptor-Activating Cytotoxic Cells; CD319; 19A24 Protein; 19A; CD319 Antigen; Membrane Protein FO
-
AA Sequence
SGTLKKVAGALDGSVTFTLNITEIKVDYVVWTFNTFFLAMVKKDGVTSQSSNKERIVFPDGLYSMKLSQLKKNDSGAYRAEIYSTSSQASLIQEYVLHVYKHLSRPKVTIDRQSNKNGTCVINLTCSTDQDGENVTYSWKAVGQGDNQFHDGATLSIAWRSGEKDQALTCMARNPVSNSFSTPVFPQKLCEDAATDLTSLRG
-
Predicted Molecular Mass
20.1 kDa
-
Molecular Weight
Approximately 30-50 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (261 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)