Copy Link Print Information

Creatine kinase M-type/CKM Protein, Human (HEK293, His)

Customer Review

Based on 1 Customer Validation

KCRM is a cytoplasmic creatine kinase isoenzyme responsible for participating in energy transduction and maintaining energy homeostasis. KCRM reversibly catalyzes phosphate transfer between ATP and various phosphogens (e.g., creatine phosphate) and is an important serum marker of myocardial infarction. Creatine kinase M-type/CKM Protein, Human (HEK293, His) is the recombinant human-derived Creatine kinase M-type/CKM protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Experimental Validation Results for Creatine kinase M-type/CKM Protein, Human (HEK293, His)
  • Creatine kinase M-type/CKM Protein, Human (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

KCRM is a cytoplasmic creatine kinase isoenzyme responsible for participating in energy transduction and maintaining energy homeostasis. KCRM reversibly catalyzes phosphate transfer between ATP and various phosphogens (e.g., creatine phosphate) and is an important serum marker of myocardial infarction. Creatine kinase M-type/CKM Protein, Human (HEK293, His) is the recombinant human-derived Creatine kinase M-type/CKM protein, expressed by HEK293 , with C-6*His labeled tag.

Background

KCRM is a cytoplasmic creatine kinase isoenzyme that reversibly catalyzes phosphate transfer between ATP and various phosphogens (e.g., creatine phosphate). KCRM is involved in energy transduction and energy homeostasis in tissues with large and fluctuating energy demands, such as skeletal muscle, heart, brain, and sperm, and is an important serum marker of myocardial infarction. KCRM acts as a homodimer in striated muscle and other tissues and as a heterodimer in the heart with similar brain isozymes. Skeletal muscle, as an important secretory organ, differentially secretes cleaved KCRM peptide in type 2 diabetes mellitus (T2DM) skeletal muscle tissue. Naturally occurring mutations in KCRM may render individuals with active serum creatine kinase unresponsive to Tenofovir (HY-13910) pre-exposure prophylaxis (PrEP) HIV.

Verified Bioactivity

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-6*His
  • Accession

    AAP35439.1 (M1-K381)

  • Gene ID
    1158  [NCBI]
  • Molecular Construction
    • N-term
    • CKM (M1-K381)
      Accession # AAP35439.1
    • 6*His
    • C-term
  • Protein Length

    Full Length

  • Synonyms

    CKM; Creatine Kinase M Chain; Prev. CKMM; CPK-M; Creatine Phosphokinase M-Type; M-CK; Creatine Kinase, Muscle; Creatine Kinase, M-Type; Creatine Kinase M-Type; rHuCreatine kinase M-type/CKMM, His

  • AA Sequence

    MPFGNTHNKFKLNYKPEEEYPDLSKHNNHMAKVLTLELYKKLRDKETPSGFTVDDVIQTGVDNPGHPFIMTVGCVAGDEESYEVFKELFDPIISDRHGGYKPTDKHKTDLNHENLKGGDDLDPNYVLSSRVRTGRSIKGYTLPPHCSRGERRAVEKLSVEALNSLTGEFKGKYYPLKSMTEKEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKSLLVWVNEEDHLRVISMEKGGNMKEVFRRFCVGLQKIEEIFKKAGHPFMWNQHLGYVLTCPSNLGTGLRGGVHVKLAHLSKHPKFEEILTRLRLQKRGTGGVDTAAVGSVFDVSNADRLGSSEVEQVQLVVDGVKLMVEMEKKLEKGQSIDDMIPAQK

  • Predicted Molecular Mass

    44.1 kDa

  • Molecular Weight

    Approximately 46 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Formulation

Supplied as a 0.22 μm filtered solution of 20 mM Tris-HCl,150 mM NaCl, 10% glycerol, pH7.5.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • Creatine kinase M-type/CKM Protein, Human (HEK293, His) Product Image
    1/16
  • Experimental Validation Results for Creatine kinase M-type/CKM Protein, Human (HEK293, His)
  • Creatine kinase M-type/CKM Protein, Human (HEK293, His) Product Image