CRIPT Protein, Human (His)

CRIPT, a pivotal member of the minor spliceosome, plays a crucial role in U12-type intron splicing, contributing to RNA splicing intricacies. Beyond its splicing function, CRIPT anchors DLG4 within excitatory synapses, interacts with RNF113A, SF3B1/SF3b155, SF3B2/SF3b145, and PHF5A/SF3b14b in the minor spliceosome complex, and strongly associates with the PDZ3 domain of DLG4 family members, highlighting its synaptic involvement. Additionally, CRIPT interacts with microtubules, indicating a role in cytoskeletal dynamics, showcasing its multifaceted contributions. CRIPT Protein, Human (His) is the recombinant human-derived CRIPT protein, expressed by E. coli, with N-His labeled tag. The total length of CRIPT Protein, Human (His) is 101 a.a., with molecular weight of ~14 kDa.

CRIPT, a crucial participant in the minor spliceosome, plays a significant role in the splicing of U12-type introns in pre-mRNAs, contributing to the intricate process of RNA splicing. Beyond its role in splicing, CRIPT is involved in the cytoskeletal anchoring of DLG4 within excitatory synapses. As a component of the minor spliceosome complex, CRIPT engages in interactions with key partners such as RNF113A, SF3B1/SF3b155, SF3B2/SF3b145, and PHF5A/SF3b14b. It also exhibits a strong interaction with the PDZ3 domain of DLG4 family members, emphasizing its role in synaptic function. Additionally, CRIPT associates with microtubules, indicating its involvement in cytoskeletal dynamics. The intricate interplay of CRIPT with various molecular partners underscores its multifaceted contributions to splicing and synaptic organization.

Human

E. coli

N-His

Q9P021 (M1-V101)

9419  [NCBI]

MVCEKCEKKLGTVITPDTWKDGARNTTESGGRKLNENKALTSKKARFDPYGKNKFSTCRICKSSVHQPGSHYCQGCAYKKGICAMCGKKVLDTKNYKQTSV

Approximately 14 kDa

Greater than 95% as determined by reducing SDS-PAGE

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 50 mM Tris, 300 mM NaCl, 5% trehalose, 5% mannitol and 0.01% Tween80, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.