CRIPT Protein, Human (His)
Based on 1 Customer Validation
CRIPT is a key member of the small spliceosome and plays a crucial role in U12-type intron splicing, contributing to the complexity of RNA splicing. CRIPT Protein, Human (His) is the recombinant human-derived CRIPT protein, expressed by E. coli , with N-His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
CRIPT is a key member of the small spliceosome and plays a crucial role in U12-type intron splicing, contributing to the complexity of RNA splicing. CRIPT Protein, Human (His) is the recombinant human-derived CRIPT protein, expressed by E. coli , with N-His labeled tag.
Background
CRIPT, a crucial participant in the minor spliceosome, plays a significant role in the splicing of U12-type introns in pre-mRNAs, contributing to the intricate process of RNA splicing. Beyond its role in splicing, CRIPT is involved in the cytoskeletal anchoring of DLG4 within excitatory synapses. As a component of the minor spliceosome complex, CRIPT engages in interactions with key partners such as RNF113A, SF3B1/SF3b155, SF3B2/SF3b145, and PHF5A/SF3b14b. It also exhibits a strong interaction with the PDZ3 domain of DLG4 family members, emphasizing its role in synaptic function. Additionally, CRIPT associates with microtubules, indicating its involvement in cytoskeletal dynamics. The intricate interplay of CRIPT with various molecular partners underscores its multifaceted contributions to splicing and synaptic organization.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-His
-
Accession
Q9P021 (M1-V101)
-
Molecular Construction
-
N-term
-
His
-
CRIPT (M1-V101)
Accession # Q9P021 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
CRIPT; Cysteine-Rich Interactor Of PDZ3; CXXC Repeat Containing Interactor Of PDZ3 Domain; Postsynaptic Protein CRIPT; Cysteine-Rich PDZ-Binding Protein; SSMDF; Cysteine-Rich Interactor Of PDZ Three; RTS3; HSPC139
-
AA Sequence
MVCEKCEKKLGTVITPDTWKDGARNTTESGGRKLNENKALTSKKARFDPYGKNKFSTCRICKSSVHQPGSHYCQGCAYKKGICAMCGKKVLDTKNYKQTSV
-
Molecular Weight
Approximately 17 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 50 mM Tris, 300 mM NaCl, 5% trehalose, 5% mannitol and 0.01% Tween 80, pH 7.4.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (235 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)