CRTAM/CD355 Protein, Human (HEK293, His)

Customer Review

Based on 1 Customer Validation

The CRTAM/CD355 protein is a key mediator of heterophilic intercellular adhesion and complexly regulates the activation, differentiation, and tissue retention of T cell subsets. Its interaction with CADM1 promotes NK cell cytotoxicity and CD8+ T cell secretion of IFNG, thus contributing to NK cell-mediated tumor rejection. CRTAM/CD355 Protein, Human (HEK293, His) is the recombinant human-derived CRTAM/CD355 protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The CRTAM/CD355 protein is a key mediator of heterophilic intercellular adhesion and complexly regulates the activation, differentiation, and tissue retention of T cell subsets. Its interaction with CADM1 promotes NK cell cytotoxicity and CD8+ T cell secretion of IFNG, thus contributing to NK cell-mediated tumor rejection. CRTAM/CD355 Protein, Human (HEK293, His) is the recombinant human-derived CRTAM/CD355 protein, expressed by HEK293 , with C-6*His labeled tag.

Background

CRTAM/CD355 Protein serves as a crucial mediator of heterophilic cell-cell adhesion, intricately regulating the activation, differentiation, and tissue retention of various T-cell subsets. Its interaction with CADM1 plays a pivotal role in promoting natural killer (NK) cell cytotoxicity, as well as IFNG/interferon-gamma secretion by CD8+ T-cells both in vitro and in vivo, contributing to NK cell-mediated rejection of CADM1-expressing tumors. CRTAM also modulates CD8+ T-cell proliferation in response to T-cell receptor (TCR) activation and, through interaction with SCRIB, facilitates the late phase of cellular polarization in a subset of CD4+ T-cells, regulating TCR-mediated proliferation and cytokine production. Moreover, CRTAM's interaction with CADM1 on CD8+ dendritic cells regulates the retention of activated CD8+ T-cells within draining lymph nodes. Essential for the intestinal retention of intraepithelial T-cell subsets, CRTAM further promotes adhesion to gut-associated CD103+ dendritic cells, facilitating the expression of gut-homing and adhesion molecules on T-cells. As a monomer that may form homodimers, CRTAM's intricate interactions, particularly with CADM1 and SCRIB, highlight its central role in orchestrating diverse cellular functions critical for immune responses and tissue homeostasis. Further exploration of these interactions will shed light on the precise mechanisms underlying CRTAM's regulatory functions.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • CRTAM (S18-S286)
      Accession # O95727-1
    • 6*His
    • C-term
  • Protein Length

    Extracellular Domain

  • Synonyms

    CRTAM; Cytotoxic And Regulatory T-Cell Molecule; Cytotoxic And Regulatory T Cell Molecule; Class I MHC Restricted T Cell Associated Molecule; CD355; CD355 Antigen; Class-I MHC-Restricted T-Cell-Associated Molecule

  • AA Sequence

    SLTNHTETITVEEGQTLTLKCVTSLRKNSSLQWLTPSGFTIFLNEYPALKNSKYQLLHHSANQLSITVPNVTLQDEGVYKCLHYSDSVSTKEVKVIVLATPFKPILEASVIRKQNGEEHVVLMCSTMRSKPPPQITWLLGNSMEVSGGTLHEFETDGKKCNTTSTLIIHTYGKNSTVDCIIRHRGLQGRKLVAPFRFEDLVTDEETASDALERNSLSSQDPQQPTSTVSVTEDSSTSEIDKEEKEQTTQDPDLTTEANPQYLGLARKKS

  • Predicted Molecular Mass

    31 kDa

  • Molecular Weight

    Approximately 64 kDa, based on SDS-PAGE under reducing conditions.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.2.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00