Copy Link Print Information

Decorin/PGS2 Protein, Mouse (HEK293, His)

Customer Review

Based on 1 Customer Validation

Decorin/PGS2 protein, influencing fibril formation rate, binds strongly to type I and type II collagen, fibronectin, and TGF-beta. It participates in extracellular matrix organization by forming a ternary complex with MFAP2 and ELN, and interacts with DPT, potentially modulating matrix assembly and structure. Decorin/PGS2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived Decorin/PGS2 protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for Decorin/PGS2 Protein, Mouse (HEK293, His)
  • Experimental Validation Results for Decorin/PGS2 Protein, Mouse (HEK293, His)
  • Decorin/PGS2 Protein, Mouse (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

Decorin/PGS2 protein, influencing fibril formation rate, binds strongly to type I and type II collagen, fibronectin, and TGF-beta. It participates in extracellular matrix organization by forming a ternary complex with MFAP2 and ELN, and interacts with DPT, potentially modulating matrix assembly and structure. Decorin/PGS2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived Decorin/PGS2 protein, expressed by HEK293 , with C-6*His labeled tag.

Background

Decorin/PGS2 protein influences the rate of fibril formation and exhibits binding affinity towards type I and type II collagen, fibronectin, and TGF-beta. It also forms a ternary complex with MFAP2 and ELN, suggesting its involvement in extracellular matrix organization. Additionally, it interacts with DPT, further highlighting its potential role in modulating matrix assembly and structure.

Verified Bioactivity

Measured by its ability to modulate collagen fibrillogenesis. 5 µg/mL of Recombinant Mouse Decorin can significantly delay the rate of collagen fibrillogenesis.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - Biochemical Activity Assay

    Bioactivity - Biochemical Activity Assay

    Measured by its ability to modulate collagen fibrillogenesis. 5 µg/mL of Recombinant Mouse Decorin can significantly delay the rate of collagen fibrillogenesis.

Technical Parameters

  • Species Mouse
  • Source HEK293
  • Tag C-6*His
  • Accession

    P28654 (G17-K354)

  • Gene ID
    13179  [NCBI]
  • Molecular Construction
    • N-term
    • PGS2 (G17-K354)
      Accession # P28654
    • 6*His
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    DCN; Decorin Proteoglycan; Decorin; Decorin Isoform 3; SLRR1B; Decorin Isoform 4; Bone Proteoglycan II; DKFZp686J19238; DSPG2; PG-S2; PG40; CSCD; Dermatan Sulphate Proteoglycans II; PGII; Small Leucine-Rich Protein 1B; PGS2; Proteoglycan Core Protein

  • AA Sequence

    GPFEQRGLFDFMLEDEASGIIPYDPDNPLISMCPYRCQCHLRVVQCSDLGLDKVPWDFPPDTTLLDLQNNKITEIKEGAFKNLKDLHTLILVNNKISKISPEAFKPLVKLERLYLSKNQLKELPEKMPRTLQELRVHENEITKLRKSDFNGLNNVLVIELGGNPLKNSGIENGAFQGLKSLSYIRISDTNITAIPQGLPTSLTEVHLDGNKITKVDAPSLKGLINLSKLGLSFNSITVMENGSLANVPHLRELHLDNNKLLRVPAGLAQHKYIQVVYLHNNNISAVGQNDFCRAGHPSRKASYSAVSLYGNPVRYWEIFPNTFRCVYVRSAIQLGNYK

  • Molecular Weight

    Approximately 41-50 kDa, based on SDS-PAGE under reducing conditions.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured by its ability to modulate collagen fibrillogenesis. 5 µg/mL of Recombinant Mouse Decorin can significantly delay the rate of collagen fibrillogenesis.

  • Decorin/PGS2 Protein, Mouse (HEK293, His) Product Image
    1/16
  • Experimental Validation Results for Decorin/PGS2 Protein, Mouse (HEK293, His)
  • Experimental Validation Results for Decorin/PGS2 Protein, Mouse (HEK293, His)
  • Decorin/PGS2 Protein, Mouse (HEK293, His) Product Image