Lumican/LUM Protein, Mouse (HEK293, His)
Based on 1 Customer Validation
Lumican/LUM protein binds specifically to laminin.Lumican/LUM Protein, Mouse (HEK293, His) is the recombinant mouse-derived Lumican/LUM protein, expressed by HEK293 , with C-6*His labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
Lumican/LUM protein binds specifically to laminin.Lumican/LUM Protein, Mouse (HEK293, His) is the recombinant mouse-derived Lumican/LUM protein, expressed by HEK293 , with C-6*His labeled tag.
Background
Lumican/LUM protein exhibits a specific binding affinity for laminin.
Verified Bioactivity
Measured by the ability of the immobilized protein to support the adhesion of A375 cells. When 5×104 cells per well are added to LUM coated plates (10 μg/mL, 100 μL/well) 52.73% will adhere after 30 minutes at 37°C.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-6*His
-
Accession
P51885 (Q19-N338)
-
Molecular Construction
-
N-term
-
Lumican (Q19-N338)
Accession # P51885 -
6*His
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
LUM; Keratan Sulfate Proteoglycan Lumican; Prev. LDC; KSPG Lumican; SLRR2D; Epididymis Secretory Sperm Binding Protein; Lumican; Lumican Proteoglycan
-
AA Sequence
QYYDYDIPLFMYGQISPNCAPECNCPHSYPTAMYCDDLKLKSVPMVPPGIKYLYLRNNQIDHIDEKAFENVTDLQWLILDHNLLENSKIKGKVFSKLKQLKKLHINYNNLTESVGPLPKSLQDLQLTNNKISKLGSFDGLVNLTFIYLQHNQLKEDAVSASLKGLKSLEYLDLSFNQMSKLPAGLPTSLLTLYLDNNKISNIPDEYFKRFTGLQYLRLSHNELADSGVPGNSFNISSLLELDLSYNKLKSIPTVNENLENYYLEVNELEKFDVKSFCKILGPLSYSKIKHLRLDGNPLTQSSLPPDMYECLRVANEITVN
-
Molecular Weight
Approximately 40-60 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (237 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
