Dectin-2/CLEC6A Protein, Human (HEK293, Fc)

Customer Review

Based on 1 Customer Validation

The Dectin-2/CLEC6A protein is a calcium-dependent lectin, a pattern recognition receptor in the innate immune system that specifically binds to Candida albicans α-mannan. Dectin-2/CLEC6A Protein, Human (HEK293, Fc) is the recombinant human-derived Dectin-2/CLEC6A protein, expressed by HEK293 , with N-hFc labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The Dectin-2/CLEC6A protein is a calcium-dependent lectin, a pattern recognition receptor in the innate immune system that specifically binds to Candida albicans α-mannan. Dectin-2/CLEC6A Protein, Human (HEK293, Fc) is the recombinant human-derived Dectin-2/CLEC6A protein, expressed by HEK293 , with N-hFc labeled tag.

Background

Dectin-2, also known as CLEC6A, functions as a calcium-dependent lectin and pattern recognition receptor (PRR) within the innate immune system, exhibiting specific recognition and binding to alpha-mannans on C. albicans hyphae. Upon binding of C. albicans alpha-mannans, this receptor complex initiates the phosphorylation of the immunoreceptor tyrosine-based activation motif (ITAM) of FCER1G, thereby activating SYK, CARD9, and NF-kappa-B. This cascade of events drives the maturation of antigen-presenting cells and influences antigen-specific priming of T-cells, favoring the development of effector T-helper 1 and T-helper 17 cell subtypes. In addition to its role in antifungal defense, Dectin-2 recognizes allergens from house dust mites and fungi in a mannose-dependent manner, promoting cysteinyl leukotriene production. Moreover, it plays a role in altering adaptive immune responses by recognizing soluble elements from the eggs of Schistosoma mansoni. Associated with FCER1G, Dectin-2 forms a heterodimer with CLEC4D, establishing a pattern recognition receptor against fungal infections. The multifaceted functions of Dectin-2 underscore its importance in immune surveillance and response mechanisms.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 90%, as determined by reducing SDS-PAGE.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag N-hFc
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • hFc
    • CLEC7A (T42-L209)
      Accession # Q6EIG7-1/NP_001007034
    • C-term
  • Protein Length

    Extracellular Domain

  • Synonyms

    CLEC6A; Dendritic Cell-Associated C-Type Lectin 2; Prev. CLECSF10; DC-Associated C-Type Lectin 2; Dectin-2; C-Type Lectin Domain Family 6, Member A; C-Type Lectin Domain Family 6 Member A; Dectin 2; HDECTIN-2; DECTIN2; C-Type (Calcium Dependent, Carbohydr

  • AA Sequence

    TYHFTYGETGKRLSELHSYHSSLTCFSEGTKVPAWGCCPASWKSFGSSCYFISSEEKVWSKSEQNCVEMGAHLVVFNTEAEQNFIVQQLNESFSYFLGLSDPQGNNNWQWIDKTPYEKNVRFWHLGEPNHSAEQCASIVFWKPTGWGWNDVICETRRNSICEMNKIYL

  • Predicted Molecular Mass

    47.9 kDa

  • Molecular Weight

    Approximately 52 kDa, based on SDS-PAGE under reducing conditions.

  • Glycosylation

    Yes

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Formulation

Supplied as a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00