Dectin-2/CLEC6A Protein, Human (HEK293, Fc)
Based on 1 Customer Validation
The Dectin-2/CLEC6A protein is a calcium-dependent lectin, a pattern recognition receptor in the innate immune system that specifically binds to Candida albicans α-mannan. Dectin-2/CLEC6A Protein, Human (HEK293, Fc) is the recombinant human-derived Dectin-2/CLEC6A protein, expressed by HEK293 , with N-hFc labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
The Dectin-2/CLEC6A protein is a calcium-dependent lectin, a pattern recognition receptor in the innate immune system that specifically binds to Candida albicans α-mannan. Dectin-2/CLEC6A Protein, Human (HEK293, Fc) is the recombinant human-derived Dectin-2/CLEC6A protein, expressed by HEK293 , with N-hFc labeled tag.
Background
Dectin-2, also known as CLEC6A, functions as a calcium-dependent lectin and pattern recognition receptor (PRR) within the innate immune system, exhibiting specific recognition and binding to alpha-mannans on C. albicans hyphae. Upon binding of C. albicans alpha-mannans, this receptor complex initiates the phosphorylation of the immunoreceptor tyrosine-based activation motif (ITAM) of FCER1G, thereby activating SYK, CARD9, and NF-kappa-B. This cascade of events drives the maturation of antigen-presenting cells and influences antigen-specific priming of T-cells, favoring the development of effector T-helper 1 and T-helper 17 cell subtypes. In addition to its role in antifungal defense, Dectin-2 recognizes allergens from house dust mites and fungi in a mannose-dependent manner, promoting cysteinyl leukotriene production. Moreover, it plays a role in altering adaptive immune responses by recognizing soluble elements from the eggs of Schistosoma mansoni. Associated with FCER1G, Dectin-2 forms a heterodimer with CLEC4D, establishing a pattern recognition receptor against fungal infections. The multifaceted functions of Dectin-2 underscore its importance in immune surveillance and response mechanisms.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag N-hFc
-
Accession
Q6EIG7-1/NP_001007034 (T42-L209)
-
Molecular Construction
-
N-term
-
hFc
-
CLEC7A (T42-L209)
Accession # Q6EIG7-1/NP_001007034 -
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
CLEC6A; Dendritic Cell-Associated C-Type Lectin 2; Prev. CLECSF10; DC-Associated C-Type Lectin 2; Dectin-2; C-Type Lectin Domain Family 6, Member A; C-Type Lectin Domain Family 6 Member A; Dectin 2; HDECTIN-2; DECTIN2; C-Type (Calcium Dependent, Carbohydr
-
AA Sequence
TYHFTYGETGKRLSELHSYHSSLTCFSEGTKVPAWGCCPASWKSFGSSCYFISSEEKVWSKSEQNCVEMGAHLVVFNTEAEQNFIVQQLNESFSYFLGLSDPQGNNNWQWIDKTPYEKNVRFWHLGEPNHSAEQCASIVFWKPTGWGWNDVICETRRNSICEMNKIYL
-
Predicted Molecular Mass
47.9 kDa
-
Molecular Weight
Approximately 52 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution
Supplied as a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)