DYDC2 Protein, Human (His)

DYDC2, or Dpy-30 domain-containing protein 2, is a member of the dpy-30 family. DYDC2 Protein, Human (GST) is the recombinant human-derived DYDC2 protein, expressed by E. coli , with N-GST labeled tag. The total length of DYDC2 Protein, Human (GST) is 75 a.a., with molecular weight of ~37 kDa.

DYDC2 Protein is a member of a family of proteins that contains a DPY30 domain. DYDC2 Protein can be used as the marker of ciliated cells. DYDC2 Protein is found expressed in endometrial tumours and positively correlated with disease-specific and overall survival of endometrial cancer patients.

Human

E. coli

C-10*His

Q96IM9 (T102-P176)

84332  [NCBI]

TIFMQEDTNPLEKEALKQEFLPGTSSLIPGMPQQVPPSESAGQIDQNFKMPQEINYKEAFQHEVAHEMPPGSKSP

Approximately 37 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.