Enterotoxin type A Protein, S. aureus (His)
Based on 1 Customer Validation
Enterotoxins (ETAs) trigger host immune system activation by binding to major histocompatibility complex class II and T-cell receptor (TCR) molecules. This interaction triggers a cascade of cell activation, cytokine production and migration, primarily mediated by Alphata T cells, affecting lung tissue and airways. Enterotoxin type A Protein, S. aureus (His) is the recombinant Staphylococcus aureus-derived Enterotoxin type A protein, expressed by E. coli , with N-6*His labeled tag.
- Species: Staphylococcus aureus
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
Enterotoxins (ETAs) trigger host immune system activation by binding to major histocompatibility complex class II and T-cell receptor (TCR) molecules. This interaction triggers a cascade of cell activation, cytokine production and migration, primarily mediated by Alphata T cells, affecting lung tissue and airways. Enterotoxin type A Protein, S. aureus (His) is the recombinant Staphylococcus aureus-derived Enterotoxin type A protein, expressed by E. coli , with N-6*His labeled tag.
Background
Enterotoxin type A (ETA) is a staphylococcal enterotoxin that instigates host immune system activation by binding in its unprocessed form to major histocompatibility complex class II and T-cell receptor (TCR) molecules. This interaction sets off a cascade of events involving waves of cellular activation, cytokine production, and migration, primarily mediated by alphabeta T-cells, ultimately affecting lung tissue and airways. Additionally, ETA is implicated in the development of staphylococcal food poisoning syndrome, characterized by symptoms such as high fever, hypotension, diarrhea, shock, and, in severe cases, potential fatality.
Technical Parameters
-
Species Staphylococcus aureus
-
Source E. coli
-
Tag N-6*His
-
Accession
P0A0L2 (S25-S257)
-
Gene ID/
-
Molecular Construction
-
N-term
-
6*His
-
SEA (S25-S257)
Accession # P0A0L2 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
Enterotoxin type A; SEA; entA
-
AA Sequence
SEKSEEINEKDLRKKSELQGTALGNLKQIYYYNEKAKTENKESHDQFLQHTILFKGFFTDHSWYNDLLVDFDSKDIVDKYKGKKVDLYGAYYGYQCAGGTPNKTACMYGGVTLHDNNRLTEEKKVPINLWLDGKQNTVPLETVKTNKKNVTVQELDLQARRYLQEKYNLYNSDVFDGKVQRGLIVFHTSTEPSVNYDLFGAQGQYSNTLLRIYRDNKTINSENMHIDIYLYTS
-
Molecular Weight
Approximately 28 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 50 mM Tris, 300 mM NaCl, 5% trehalose, 5% mannitol and 0.01% Tween 80, pH 7.4.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (392 KB)
- English - EN (392 KB)
- Français - FR (392 KB)
- Deutsch - DE (392 KB)
- Norwegian - NO (392 KB)
- Español - ES (392 KB)
- Swedish - SV (392 KB)
- Italian - IT (392 KB)
- Korean - KR (392 KB)
- Portuguese - PT (392 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
