1. Recombinant Proteins
  2. Others
  3. ERH Protein, Human (N-His)

ERH proteins are involved in regulating the cell cycle and have been shown to be involved in cell division and proliferation processes. Structurally forming homodimers, it suggests potential functional significance. ERH Protein, Human (N-His) is the recombinant human-derived ERH protein, expressed by E. coli , with N-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

ERH proteins are involved in regulating the cell cycle and have been shown to be involved in cell division and proliferation processes. Structurally forming homodimers, it suggests potential functional significance. ERH Protein, Human (N-His) is the recombinant human-derived ERH protein, expressed by E. coli , with N-His labeled tag.

Background

The ERH protein is suggested to play a role in the regulation of the cell cycle, indicating its potential involvement in the intricate processes governing cell division and proliferation. Structurally, it forms homodimers, a characteristic indicative of its molecular arrangement and potential functional significance. Moreover, ERH interacts with POLDIP3 and is a component of the methylosome, a 20S complex that includes CLNS1A/pICln, PRMT5/SKB1, WDR77/MEP50, PRMT1, and ERH. This complex, as identified in studies, implies ERH's participation in protein methylation processes. Additionally, ERH interacts with CHTOP, further suggesting its engagement in diverse molecular pathways and highlighting its multifaceted role within cellular mechanisms.

Species

Human

Source

E. coli

Tag

N-His

Accession

P84090 (M1-K104)

Gene ID
Molecular Construction
N-term
His
ERH (M1-K104)
Accession # P84090
C-term
Protein Length

Full Length

Synonyms
Enhancer of rudimentary homolog; ERH
AA Sequence

MSHTILLVQPTKRPEGRTYADYESVNECMEGVCKMYEEHLKRMNPNSPSITYDISQLFDFIDDLADLSCLVYRADTQTYQPYNKDWIKEKIYVLLRRQAQQAGK

Molecular Weight

Approximately 15 kDa

Purity

≥ 95%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 50 mM Tris, 300 mM NaCl, 5% trehalose, 5% mannitol and 0.01% Tween 80, pH 7.4.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

ERH Protein, Human (N-His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

ERH Protein, Human (N-His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
ERH Protein, Human (N-His)
Cat. No.:
HY-P74169
Quantity:
MCE Japan Authorized Agent: