ERH Protein, Human (N-His)
Based on 1 Customer Validation
ERH proteins are involved in regulating the cell cycle and have been shown to be involved in cell division and proliferation processes. Structurally forming homodimers, it suggests potential functional significance. ERH Protein, Human (N-His) is the recombinant human-derived ERH protein, expressed by E. coli , with N-His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
ERH proteins are involved in regulating the cell cycle and have been shown to be involved in cell division and proliferation processes. Structurally forming homodimers, it suggests potential functional significance. ERH Protein, Human (N-His) is the recombinant human-derived ERH protein, expressed by E. coli , with N-His labeled tag.
The ERH protein is suggested to play a role in the regulation of the cell cycle, indicating its potential involvement in the intricate processes governing cell division and proliferation. Structurally, it forms homodimers, a characteristic indicative of its molecular arrangement and potential functional significance. Moreover, ERH interacts with POLDIP3 and is a component of the methylosome, a 20S complex that includes CLNS1A/pICln, PRMT5/SKB1, WDR77/MEP50, PRMT1, and ERH. This complex, as identified in studies, implies ERH's participation in protein methylation processes. Additionally, ERH interacts with CHTOP, further suggesting its engagement in diverse molecular pathways and highlighting its multifaceted role within cellular mechanisms.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-His
-
Accession
P84090 (M1-K104)
-
Molecular Construction
-
N-term
-
His
-
ERH (M1-K104)
Accession # P84090 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
ERH; DROER; ERH MRNA Splicing And Mitosis Factor; Enhancer Of Rudimentary (Drosophila) Homolog; Enhancer Of Rudimentary Homolog; Enhancer Of Rudimentary Homolog (Drosophila)
-
AA Sequence
MSHTILLVQPTKRPEGRTYADYESVNECMEGVCKMYEEHLKRMNPNSPSITYDISQLFDFIDDLADLSCLVYRADTQTYQPYNKDWIKEKIYVLLRRQAQQAGK
-
Predicted Molecular Mass
14.4 kDa
-
Molecular Weight
Approximately 15 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 50 mM Tris, 300 mM NaCl, 5% trehalose, 5% mannitol and 0.01% Tween 80, pH 7.4.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (235 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
