Fas Ligand Protein, Mouse (P.pastoris, His)
Based on 1 publication(s) in Google Scholar
Fas Ligand (CD178; APTL) is a ligand to TNFRSF6/FAS, transduces the apoptotic signal to regulate cytotoxic T-cell-mediated apoptosis, natural killer cell-mediated apoptosis and in T-cell development. Mouse Fas Ligand has a total length of 279 amino acids (M1-L279), with a TNF_2 domain (144-279 a.a.). Fas Ligand Protein, Mouse (P.pastoris, His) is a recombinant protein expressed in P.pastoris cells with N-terminal His-tag.
- Species: Mouse
- Source: P. pastoris
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
Fas Ligand (CD178; APTL) is a ligand to TNFRSF6/FAS, transduces the apoptotic signal to regulate cytotoxic T-cell-mediated apoptosis, natural killer cell-mediated apoptosis and in T-cell development[1]. Mouse Fas Ligand has a total length of 279 amino acids (M1-L279), with a TNF_2 domain (144-279 a.a.). Fas Ligand Protein, Mouse (P.pastoris, His) is a recombinant protein expressed in P.pastoris cells with N-terminal His-tag.
Background
Fas Ligand (FasL; FASLG; CD95L), is a ligand for TNFRSF6/FAS belonging to the tumor necrosis factor (TNF). FasL is a type II transmembrane protein, riggering apoptosis of lymphocytes[1].
FasL is expressed on a variety of cell types, including T cells, natural killer (NK) cells, monocytes, neutrophils, breast epithelial cells, and vascular endothelial cells[2].
FasL exerts different biological activity by cleaved into 4 isoforms including membrane form, soluble form, ADAM10-processed FasL form (APL) and SPPL2A-processed FasL form (SPA). Among them, the membrane-bound form and a soluble form generated by proteolytic action of matrix metalloproteinases (MMP)[2].
FasL or soluble FasL binding to Fas results in receptor aggregation and in the interaction of a protein called Fas-associated death domain with the Fas cytoplasmic tail. The interaction triggers a cascade of intracellular events, including the activation of the IL-1-converting enzyme-like cysteine protease (caspase 8), that ultimately leads to nucleoprotein cleavage, DNA fragmentation, and cell apoptosis[4].
The loss of function due to mutations in murine FasL, murine Fas, human Fas, or human FasL leads to lymphoproliferation, lymphadenopathy, and autoimmune diseases[1][3].
Meanwhile, defective activation-induced cell death (AICD) results in spontaneous mutation of Fas and FasL genes in mice with lupus-like autoimmune disease[3].
Human Fas Ligand also involves in Jurkat cell apoptosis and binds TNFRSF6B/DcR3 to bolck apoptosis, which is a decoy receptor of apoptosis termination[2].
FasL is widely found in different animals, while the sequence in Mouse is highly similar to Rat (91.37%), but very different from Human with similarity of 78.06%.
In Vitro
Recombinant mouse soluble FasL (WX1) (4 units/mL; 18 hr) fails to induce IL-1β release from inflammatory cells, suggests that the IL-1β enhances neutrophil infiltration[6].
Publications (1)
-
Journal Impact Factor
-
Most Recent
-
iScience
CPNE5 overexpression inhibits cardiomyocytes apoptosis by promoting the degradation of FAS receptor. [Abstract]2025 Aug 6;28(9):113302. PMID: 40894904
Technical Parameters
-
Species Mouse
-
Source P. pastoris
-
Tag N-His
-
Accession
Q544E9 (P132-L279)
-
Molecular Construction
-
N-term
-
His
-
Fas Ligand (P132-L279)
Accession # Q544E9 -
C-term
-
-
Protein Length
Partial
-
Synonyms
FASLG; TNLG1A; Prev. APT1LG1; CD95L; Prev. TNFSF6; APTL; FasL; Tumor Necrosis Factor (Ligand) Superfamily, Member 6; Tumor Necrosis Factor Ligand Superfamily Member 6; Mutant Tumor Necrosis Factor Family Member 6; Fas Antigen Ligand; Apoptosis (APO-1) Ant
-
AA Sequence
PSTPSEKKEPRSVAHLTGNPHSRSIPLEWEDTYGTALISGVKYKKGGLVINETGLYFVYSKVYFRGQSCNNQPLNHKVYMRNSKYPEDLVLMEEKRLNYCTTGQIWAHSSYLGAVFNLTSADHLYVNISQLSLINFEESKTFFGLYKL
-
Predicted Molecular Mass
18.2 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (264 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
References
[1]. Schneider P, et al. Characterization of Fas (Apo-1, CD95)-Fas ligand interaction. J Biol Chem. 1997 Jul 25;272(30):18827-33. [Content Brief]
[2]. Liu W, et al. Crystal Structure of the Complex of Human FasL and Its Decoy Receptor DcR3. Structure. 2016 Nov 1;24(11):2016-2023. [Content Brief]
[3]. Martínez-Lorenzo MJ, et al. Release of preformed Fas ligand in soluble form is the major factor for activation-induced death of Jurkat T cells. Immunology. 1996 Dec;89(4):511-7. [Content Brief]
[4]. Puppo F, et al. Fas, Fas ligand, and transfusion immunomodulation. Transfusion. 2001 Mar;41(3):416-8. [Content Brief]
[5]. Miwa K, et al. Caspase 1-independent IL-1beta release and inflammation induced by the apoptosis inducer Fas ligand. Nat Med. 1998 Nov;4(11):1287-92. [Content Brief]
[6]. Shudo K, et al. The membrane-bound but not the soluble form of human Fas ligand is responsible for its inflammatory activity. Eur J Immunol. 2001 Aug;31(8):2504-11. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)