1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. FGF family
  4. FGF
  5. FGF-18 Protein, Human

FGF-18 Protein, Human

Cat. No.: HY-P7123
Handling Instructions

FGF-18 Protein, Human is a heparin-binding polypeptide growth factor, involved in cartilage growth, maturation and the development of functional cartilage and bone tissue.

For research use only. We do not sell to patients.

Protein Expression Service

Recombinant Proteins-MedChemExpress
Size Price Stock Quantity
10 μg $120 In-stock
Estimated Time of Arrival: December 31
50 μg $320 In-stock
Estimated Time of Arrival: December 31
100 μg   Get quote  
250 μg   Get quote  

* Please select Quantity before adding items.

FGF-18 Protein, Human Featured Recommendations:

Top Publications Citing Use of Products

FGF-18 Protein, Human Related Classifications

  • Technical Parameters

  • Properties

  • Documentation

Species

Human

Source

E. coli

Tag

Tag Free

Accession

O76093 (A27-R199)

Gene ID

8817

Synonyms
rHuFGF-18; zFGF5; FGF18
AA Sequence

MAEENVDFRIHVENQTRARDDVSRKQLRLYQLYSRTSGKHIQVLGRRISARGEDGDKYAQLLVETDTFGSQVRIKGKETEFYLCMNRKGKLVGKPDGTSKECVFIEKVLENNYTALMSAKYSGWYVGFTKKGRPRKGPKTRENQQDVHFMKRYPKGQPELQKPFKYTTVTKRSR

Molecular Weight

Approximately 20.3 kDa

Biological Activity
The ED50 is <10 ng/mL as measured by 3T3 cells, corresponding to a specific activity of > 1.0 × 105 units/mg.
Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against PBS.

Endotoxin Level

<0.2 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O or PBS.

Storage & Stability

Stored at -20°C. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Background

Fibroblast growth factor 18 (FGF18), a secreted heparin-binding polypeptide growth factor, is related to FGF8 and 175 and has been shown to have a number of functions in different organs. FGF18 is involved in cartilage growth and maturation and is implicated in the development of functional cartilage and bone tissue. It is also involved in processes within mature cartilage10-13 as well as being shown to have a role in enhancing regeneration and repair[1]. Fibroblast growth factor 18 (FGF18) acts as an important role in skeletal growth and limb development, potentially through the modulation of osteoblasts, chondrocytes, and osteoclasts[2].

Documentation
References
  • Reconstitution Calculator

  • Dilution Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
FGF-18 Protein, Human
Cat. No.:
HY-P7123
Quantity:
MCE Japan Authorized Agent: