Copy Link Print Information

Animal-Free FGF-22 Protein, Human (His-SUMO)

Customer Review

Based on 1 Customer Validation

FGF-22 Protein, multifaceted in physiological processes, influences fasting response, glucose homeostasis, lipolysis, and lipogenesis.It stimulates in vitro cell proliferation and may contribute to hair development.Functionally, FGF-22 forms complexes with FGFR1 and FGFR2, integral to FGF signaling pathways.Interactions with FGFBP1 highlight its role in finely tuned regulatory networks governing cellular and metabolic activities.Animal-Free FGF-22 Protein, Human (His) is the recombinant human-derived animal-FreeFGF-22 protein, expressed by E.coli , with N-SUMO, N-His labeled tag.This product is for cell culture use only.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Animal-Free FGF-22 Protein, Human (His-SUMO) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

FGF-22 Protein, multifaceted in physiological processes, influences fasting response, glucose homeostasis, lipolysis, and lipogenesis.It stimulates in vitro cell proliferation and may contribute to hair development.Functionally, FGF-22 forms complexes with FGFR1 and FGFR2, integral to FGF signaling pathways.Interactions with FGFBP1 highlight its role in finely tuned regulatory networks governing cellular and metabolic activities.Animal-Free FGF-22 Protein, Human (His) is the recombinant human-derived animal-FreeFGF-22 protein, expressed by E.coli , with N-SUMO, N-His labeled tag.This product is for cell culture use only.

Background

FGF-22, a multifaceted protein, is intricately involved in diverse physiological processes, including the fasting response, glucose homeostasis, lipolysis, and lipogenesis. Beyond its metabolic roles, FGF-22 exhibits the capacity to stimulate cell proliferation in vitro, highlighting its impact on cellular dynamics. Moreover, the protein may contribute to the intricate processes underlying hair development. Functionally, FGF-22 engages in significant molecular interactions, forming complexes with FGFR1 and FGFR2, essential players in FGF signaling pathways. Additionally, it interacts with FGFBP1, further emphasizing its involvement in finely tuned regulatory networks that govern various cellular and metabolic activities.

Verified Bioactivity

The ED50 is <2 ng/mL as measure by its ability to induce 3T3 cells proliferation.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag N-SUMO;N-6*His
  • Accession

    Q9HCT0 (T23-S170)

  • Gene ID
    27006  [NCBI]
  • Molecular Construction
    • N-term
    • 6*His-SUMO
    • FGF-22 (T23-S170)
      Accession # Q9HCT0
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    FGF22; Fibroblast Growth Factor; Fibroblast Growth Factor 22; FGF; FGF-22

  • AA Sequence

    TPSASRGPRSYPHLEGDVRWRRLFSSTHFFLRVDPGGRVQGTRWRHGQDSILEIRSVHVGVVVIKAVSSGFYVAMNRRGRLYGSRLYTVDCRFRERIEENGHNTYASQRWRRRGQPMFLALDRRGGPRPGGRTRRYHLSAHFLPVLVS

  • Predicted Molecular Mass

    29.4 kDa

  • Molecular Weight

    Approximately 36 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 8.0, trehalose.

Endotoxin Level

<0.1 EU per 1 μg of the protein by the LAL method.

Reconstitution

It is recommended to reconstitute to a concentration of 100-200 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • Animal-Free FGF-22 Protein, Human (His-SUMO) Product Image
    1/16
  • Animal-Free FGF-22 Protein, Human (His-SUMO) Product Image