Animal-Free FGF-22 Protein, Human (His)

FGF-22 Protein, multifaceted in physiological processes, influences fasting response, glucose homeostasis, lipolysis, and lipogenesis. It stimulates in vitro cell proliferation and may contribute to hair development. Functionally, FGF-22 forms complexes with FGFR1 and FGFR2, integral to FGF signaling pathways. Interactions with FGFBP1 highlight its role in finely tuned regulatory networks governing cellular and metabolic activities. Animal-Free FGF-22 Protein, Human (His) is the recombinant human-derived animal-FreeFGF-22 protein, expressed by E. coli, with N-SUMO, N-His labeled tag. The total length of Animal-Free FGF-22 Protein, Human (His) is 148 a.a., with molecular weight of ~29.35 kDa.

FGF-22, a multifaceted protein, is intricately involved in diverse physiological processes, including the fasting response, glucose homeostasis, lipolysis, and lipogenesis. Beyond its metabolic roles, FGF-22 exhibits the capacity to stimulate cell proliferation in vitro, highlighting its impact on cellular dynamics. Moreover, the protein may contribute to the intricate processes underlying hair development. Functionally, FGF-22 engages in significant molecular interactions, forming complexes with FGFR1 and FGFR2, essential players in FGF signaling pathways. Additionally, it interacts with FGFBP1, further emphasizing its involvement in finely tuned regulatory networks that govern various cellular and metabolic activities.

The ED₅₀ is <2 ng/mL as measure by its ability to induce 3T3 cells proliferation.

Human

E. coli

N-SUMO

Q9HCT0 (T23-S170)

27006  [NCBI]

TPSASRGPRSYPHLEGDVRWRRLFSSTHFFLRVDPGGRVQGTRWRHGQDSILEIRSVHVGVVVIKAVSSGFYVAMNRRGRLYGSRLYTVDCRFRERIEENGHNTYASQRWRRRGQPMFLALDRRGGPRPGGRTRRYHLSAHFLPVLVS

Approximately 29.35 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a solution containing 1X PBS, pH 8.0.

<0.1 EU per 1 μg of the protein by the LAL method.

It is not recommended to reconstitute to a concentration less than 10 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.