1. Recombinant Proteins
  2. Cytokines and Growth Factors Biotinylated Proteins
  3. FGF Family
  4. Fibroblast Growth Factor
  5. Fibroblast Growth Factor 21 (FGF-21)
  6. FGF-21 Protein, Human (Biotinylated, HEK293, mFc-Avi)

FGF-21 Protein, Human (Biotinylated, HEK293, mFc-Avi)

Cat. No.: HY-P700719
Handling Instructions Technical Support

FGF-21 Proteinas, pivotal in promoting glucose uptake in adipocytes, induces SLC2A1/GLUT1 expression, not affecting SLC2A4/GLUT4, contingent on KLB.It significantly regulates systemic glucose homeostasis and insulin sensitivity, with direct KLB interaction via its C-terminus.Engagement with FGFR4 adds complexity to its molecular mechanisms, highlighting its role in orchestrating cellular responses beyond localized effects.FGF-21 Protein, Human (Biotinylated, HEK293, mFc-Avi) is the recombinant human-derived FGF-21 protein, expressed by HEK293 , with N-Avi, N-mFc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
20 μg Get quote 2 - 3 Weeks 1 - 2 Weeks 3 - 4 Weeks 2 - 3 weeks
50 μg Get quote 2 - 3 Weeks 1 - 2 Weeks 3 - 4 Weeks 2 - 3 weeks
100 μg Get quote 2 - 3 Weeks 1 - 2 Weeks 3 - 4 Weeks 2 - 3 weeks
> 100 μg   Get quote  
Synthetic products have potential research and development risk.

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

FGF-21 Proteinas, pivotal in promoting glucose uptake in adipocytes, induces SLC2A1/GLUT1 expression, not affecting SLC2A4/GLUT4, contingent on KLB.It significantly regulates systemic glucose homeostasis and insulin sensitivity, with direct KLB interaction via its C-terminus.Engagement with FGFR4 adds complexity to its molecular mechanisms, highlighting its role in orchestrating cellular responses beyond localized effects.FGF-21 Protein, Human (Biotinylated, HEK293, mFc-Avi) is the recombinant human-derived FGF-21 protein, expressed by HEK293 , with N-Avi, N-mFc labeled tag.

Background

The FGF-21 protein plays a pivotal role in promoting glucose uptake within differentiated adipocytes by specifically inducing the expression of the glucose transporter SLC2A1/GLUT1, while not affecting SLC2A4/GLUT4 expression. Its activity is contingent upon the presence of KLB. Beyond its localized effects, this protein contributes significantly to the regulation of systemic glucose homeostasis and insulin sensitivity. The direct interaction with KLB, facilitated via its C-terminus, underscores the molecular basis of its functionality. Additionally, the protein engages with FGFR4, further highlighting the complexity of its interactions in orchestrating cellular responses.

Biological Activity

Immobilized Biotinylated Human FGF21, mFc Tag at 2μg/ml (100μl/well) on the streptavidin precoated plate (5μg/ml). Dose response curve for Human Beta Klotho, His Tag with the EC50 of 0.26μg/ml determined by ELISA.

Species

Human

Source

HEK293

Tag

N-Avi;N-mFc

Accession

Q9NSA1 (H29-S209)

Gene ID
Molecular Construction
N-term
mFc-Avi
FGF-21 (H29-S209)
Accession # Q9NSA1
C-term
Protein Length

Full Length of Mature Protein

Conjugation

Biotin

Synonyms
UNQ3115; PRO10196; FGF-21; FGF21
AA Sequence

HPIPDSSPLLQFGGQVRQRYLYTDDAQQTEAHLEIREDGTVGGAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEACSFRELLLEDGYNVYQSEAHGLPLHLPGNKSPHRDPAPRGPARFLPLPGLPPALPEPPGILAPQPPDVGSSDPLSMVGPSQGRSPSYAS

Predicted Molecular Mass
46.9 kDa
Molecular Weight

Approximately 55-65 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.

Purity

≥ 95%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Normally 8% trehalose is added as protectant before lyophilization.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

FGF-21 Protein, Human (Biotinylated, HEK293, mFc-Avi) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

FGF-21 Protein, Human (Biotinylated, HEK293, mFc-Avi)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
FGF-21 Protein, Human (Biotinylated, HEK293, mFc-Avi)
Cat. No.:
HY-P700719
Quantity:
MCE Japan Authorized Agent: