FGF-21 Protein, Human (Biotinylated, HEK293, mFc-Avi)
FGF-21 Proteinas, pivotal in promoting glucose uptake in adipocytes, induces SLC2A1/GLUT1 expression, not affecting SLC2A4/GLUT4, contingent on KLB.It significantly regulates systemic glucose homeostasis and insulin sensitivity, with direct KLB interaction via its C-terminus.Engagement with FGFR4 adds complexity to its molecular mechanisms, highlighting its role in orchestrating cellular responses beyond localized effects.FGF-21 Protein, Human (Biotinylated, HEK293, mFc-Avi) is the recombinant human-derived FGF-21 protein, expressed by HEK293 , with N-Avi, N-mFc labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
FGF-21 Proteinas, pivotal in promoting glucose uptake in adipocytes, induces SLC2A1/GLUT1 expression, not affecting SLC2A4/GLUT4, contingent on KLB.It significantly regulates systemic glucose homeostasis and insulin sensitivity, with direct KLB interaction via its C-terminus.Engagement with FGFR4 adds complexity to its molecular mechanisms, highlighting its role in orchestrating cellular responses beyond localized effects.FGF-21 Protein, Human (Biotinylated, HEK293, mFc-Avi) is the recombinant human-derived FGF-21 protein, expressed by HEK293 , with N-Avi, N-mFc labeled tag.
Background
The FGF-21 protein plays a pivotal role in promoting glucose uptake within differentiated adipocytes by specifically inducing the expression of the glucose transporter SLC2A1/GLUT1, while not affecting SLC2A4/GLUT4 expression. Its activity is contingent upon the presence of KLB. Beyond its localized effects, this protein contributes significantly to the regulation of systemic glucose homeostasis and insulin sensitivity. The direct interaction with KLB, facilitated via its C-terminus, underscores the molecular basis of its functionality. Additionally, the protein engages with FGFR4, further highlighting the complexity of its interactions in orchestrating cellular responses.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag N-Avi;N-mFc
-
Accession
Q9NSA1 (H29-S209)
-
Molecular Construction
-
N-term
-
mFc-Avi
-
FGF-21 (H29-S209)
Accession # Q9NSA1 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Conjugation
Biotin
-
Synonyms
FGF21; FGF-21; Fibroblast Growth Factor 21; FGF; Fibroblast Growth Factor
-
AA Sequence
HPIPDSSPLLQFGGQVRQRYLYTDDAQQTEAHLEIREDGTVGGAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEACSFRELLLEDGYNVYQSEAHGLPLHLPGNKSPHRDPAPRGPARFLPLPGLPPALPEPPGILAPQPPDVGSSDPLSMVGPSQGRSPSYAS
-
Predicted Molecular Mass
46.9 kDa
-
Molecular Weight
Approximately 55-65 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)