Copy Link Print Information

FGF-9 Protein, Mouse (His)

Customer Review

Based on 1 Customer Validation

FGF-9 is a member of mouse heparin-binding fibroblast growth factors located on the outside of cell membranes. FGF-9 is a regulator of chondrogenesis and vascularization during bone development. FGF-9 binds to fibroblast growth factor receptors (FGFRs) to activate downstream signaling pathways, such as PI3K-AKT, RAS-MAPK and protein kinase C (PKC) pathways. FGF-9 regulates embryonic development, cell proliferation, cell differentiation and cell migration. FGF-9 plays an important role in differentiation, survival of neuronal cells and growth stimulation of glial tumors. FGF-9 Protein, Mouse (His) is a recombinant protein with a N-His label and is produced in E. coli.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for FGF-9 Protein, Mouse (His)
  • FGF-9 Protein, Mouse (His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

FGF-9 is a member of mouse heparin-binding fibroblast growth factors located on the outside of cell membranes. FGF-9 is a regulator of chondrogenesis and vascularization during bone development. FGF-9 binds to fibroblast growth factor receptors (FGFRs) to activate downstream signaling pathways, such as PI3K-AKT, RAS-MAPK and protein kinase C (PKC) pathways. FGF-9 regulates embryonic development, cell proliferation, cell differentiation and cell migration. FGF-9 plays an important role in differentiation, survival of neuronal cells and growth stimulation of glial tumors. FGF-9 Protein, Mouse (His) is a recombinant protein with a N-His label and is produced in E. coli[1][2][3][4][5].

Background

Fibroblast growth factors are important growth factors for physiological systems, and play critical and multifunctional roles during development, tumorigenesis, neuronal systems and disease progressions. FGF-9 Protein (Mouse) involves in neuronal disorders, plays an important role for brain development and functions[1].
FGF-9 Protein (Mouse) expression is principally restricted to the splanchnic mesodermal plate (SMP) and the mesothelium during early development, then subsequently expressed by both the mesothelium and rare epithelial cells splanchnic mesodermal plate (SMP) of mice[1].
Loss of FGF-9 Protein (Mouse) in mice leads to pancreatic hypoplasia and asplenia[1].
FGF-9 Protein (Mouse) reduces TBHP-induced oxidative stress in chondrocytes and diminishes mouse osteoarthritis by activating ERK/Nrf2 signaling pathway[2].
FGF-9 Protein (Mouse) inhibits cell apoptosis and senescence by activating intracellular HO-1 and γ-GCSc in PD models, upregulated Nrf2 expression and enhanced antioxidant effects in HD striatal cells[2].
FGF-9 Protein (Mouse) attenuates sepsis-induced fulminant hepatitis in mice[3].
FGF-9 Protein (Mouse) alleviates the infltration of neutrophils into the liver, and decreased the serum levels of pro‐infammatory cytokines such as tumor necrosis factor-alpha (TNF-α) and interleukin-6 (IL-6) in Lipopolysaccharide (LPS) (HY-D1056)/D-galactosamine (D-Gal) (HY-42682) (LPS/D-Gal)-challenged mice[3].
FGF-9 Protein (Mouse) facilitates palatal growth and timely elevation by regulating cell proliferation and hyaluronic acid accumulation in mice[4].

In Vitro

FGF-9 Protein (Mouse) (50, 100 ng/mL) protects chondrocytes against apoptosis from tert-butyl hydroperoxide (TBHP) (40 μM)-induced cellular damage[2].
FGF-9 Protein (Mouse) (100 ng/mL) reduces TBHP (40 μM)-induced oxidative stress, mitochondrial dysfunction and arouses the Nrf2 signaling pathway in chondrocytes[2].

In Vivo

Loss of FGF-9 Protein (Mouse) leads to asplenia, abnormal pancreatic and gastric development, hypoplastic lungs leading to respiratory failure in mice with a functional knockout of FGF-9. Additionally, loss of FGF-9 Protein (Mouse) reduces numbers of early pancreatic progenitors and displays defects in epithelial structure and mesothelial development in mice with a functional knockout of FGF-9[1].
FGF-9 Protein (Mouse) (1 µg/kg, intraarticular injection, daily for 8 weeks) ameliorates osteoarthritis (OA) in medial meniscus instability (DMM) mice[2].
FGF-9 Protein (Mouse) (0.5 or 1.5 mg/kg, i.p., administered 1 h before and after intraperitoneal injection of LPS/D-Gal) signifcantly attenuates LPS/D-Gal-induced liver damage in mice[3].
FGF-9 Protein (Mouse)−/− mouse embryos displays defective palatal growth and palatal elevation, exhibits aberrant cell proliferation and increases cell density, impairs palatal growth and elevation due to abnormal HA accumulation and cell proliferation[4].
Loss of FGF-9 Protein (Mouse) in mouse tendon progenitors leads to impaired apophyseal, entheseal growth and enthesis mechanical properties[5].

Verified Bioactivity

Measured in a cell proliferation assay using NIH/3T3 mouse fibroblast cells in the presence of 10 µg/mL of heparin. The ED50 is 0.4023 ng /mL.

Technical Parameters

  • Species Mouse
  • Source E. coli
  • Tag N-6*His
  • Accession

    P54130 (A2-S208)

  • Gene ID
    14180  [NCBI]
  • Molecular Construction
    • N-term
    • 6*His
    • FGF-9 (A2-S208)
      Accession # P54130
    • C-term
  • Protein Length

    Full Length of Fibroblast growth factor 9 Chain

  • Synonyms

    FGF9; FGF-9; Fibroblast Growth Factor 9; GAF; Fibroblast Growth Factor 9 (Glia-Activating Factor); Fibroblast Growth Factor; Heparin-Binding Growth Factor 9; HBFG-9; Glia-Activating Factor; SYNS3; HBGF-9; FGF

  • AA Sequence

    APLGEVGSYFGVQDAVPFGNVPVLPVDSPVLLSDHLGQSEAGGLPRGPAVTDLDHLKGILRRRQLYCRTGFHLEIFPNGTIQGTRKDHSRFGILEFISIAVGLVSIRGVDSGLYLGMNEKGELYGSEKLTQECVFREQFEENWYNTYSSNLYKHVDTGRRYYVALNKDGTPREGTRTKRHQKFTHFLPRPVDPDKVPELYKDILSQS

  • Predicted Molecular Mass

    24.1 kDa

  • Molecular Weight

    Approximately 28 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 20 mM Tris, 500 mM NaCl, pH 8.5.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

[1]. Patzek S, et al. Loss of Fgf9 in mice leads to pancreatic hypoplasia and asplenia. iScience. 2023 Mar 25;26(4):106500. [Content Brief]

[2]. Pan YN, et al. Fibroblast growth factor 9 reduces TBHP-induced oxidative stress in chondrocytes and diminishes mouse osteoarthritis by activating ERK/Nrf2 signaling pathway. Int Immunopharmacol. 2023 Jan;114:109606. [Content Brief]

[3]. Li A, et al. Fibroblast growth factor 9 attenuates sepsis-induced fulminant hepatitis in mice. Amino Acids. 2022 Jul;54(7):1069-1081. [Content Brief]

[4]. Li R, Sun Y, et al. The Fibroblast Growth Factor 9 (Fgf9) Participates in Palatogenesis by Promoting Palatal Growth and Elevation. Front Physiol. 2021 Apr 20;12:653040. [Content Brief]

[5]. Ganji E, et al. Targeted deletion of Fgf9 in tendon disrupts mineralization of the developing enthesis. FASEB J. 2023 Mar;37(3):e22777. doi: 10.1096/fj.202201614R. Erratum in: FASEB J. 2023 Apr;37(4):e22856. [Content Brief]

View More

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • FGF-9 Protein, Mouse (His) Product Image
    1/16
  • Experimental Validation Results for FGF-9 Protein, Mouse (His)
  • FGF-9 Protein, Mouse (His) Product Image