FGF-9 Protein, Mouse (N-His)

FGF-9 Protein, Mouse (His) is a member of mouse fibroblast growth factors, Plays an important role in brain development and functions.

Fibroblast growth factors are important growth factors for physiological systems, and play critical and multifunctional roles during development, tumorigenesis, neuronal systems and disease progressions. FGF9 involves in neuronal disorders, plays an important role for brain development and functions^[1].

Measured in a cell proliferation assay using NIH/3T3 mouse fibroblast cells in the presence of 10 µg/mL of heparin. The ED₅₀ is 0.4023 ng /mL.

Mouse

E. coli

N-6*His

P54130 (A2-S208)

14180  [NCBI]

APLGEVGSYFGVQDAVPFGNVPVLPVDSPVLLSDHLGQSEAGGLPRGPAVTDLDHLKGILRRRQLYCRTGFHLEIFPNGTIQGTRKDHSRFGILEFISIAVGLVSIRGVDSGLYLGMNEKGELYGSEKLTQECVFREQFEENWYNTYSSNLYKHVDTGRRYYVALNKDGTPREGTRTKRHQKFTHFLPRPVDPDKVPELYKDILSQS

Approximately 27.91 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 20 mM Tris, 500 mM NaCl, pH 8.5.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.