FGFR1OP Protein, Human (sf9, His-GST)
FGFR1OP is critical for microtubule dynamics, anchoring microtubules at centrosomes, which is critical for cell organization. It plays an integral role in cilia formation and helps control the complex process of cilia formation. FGFR1OP Protein, Human (sf9, His-GST) is the recombinant human-derived FGFR1OP protein, expressed by Sf9 insect cells , with N-His, N-GST labeled tag.
- Species: Human
- Source: Sf9 insect cells
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
FGFR1OP is critical for microtubule dynamics, anchoring microtubules at centrosomes, which is critical for cell organization. It plays an integral role in cilia formation and helps control the complex process of cilia formation. FGFR1OP Protein, Human (sf9, His-GST) is the recombinant human-derived FGFR1OP protein, expressed by Sf9 insect cells , with N-His, N-GST labeled tag.
Background
FGFR1OP plays a crucial role in microtubule dynamics by serving as an essential factor for anchoring microtubules to the centrosomes, emphasizing its significance in cellular organization. Furthermore, FGFR1OP is indispensable for ciliation, contributing to the intricate processes that govern the formation and maintenance of cellular cilia. Structurally, FGFR1OP forms homodimers and is a component of a ternary complex, along with CEP350 and MAPRE1, highlighting its participation in molecular interactions critical for centrosomal and microtubule-associated functions. The direct interactions of FGFR1OP with CEP350 and MAPRE1 underscore its role in coordinating the assembly and organization of cellular structures. Additionally, FGFR1OP engages with CEP19, further expanding its network of interactions and implicating its involvement in various cellular processes.
Technical Parameters
-
Species Human
-
Source Sf9 insect cells
-
Tag N-His;N-GST
-
Accession
O95684-2 (A2-A379)
-
Molecular Construction
-
N-term
-
His-GST
-
FGFR1OP (A2-A379)
Accession # O95684-2 -
C-term
-
-
Protein Length
Full Length of Isoform-2
-
Synonyms
CEP43; FGFR1 Oncogene Partner; Prev. FGFR1OP; Fibroblast Growth Factor Receptor 1 Oncogene Partner; Centrosomal Protein 43; FOP
-
AA Sequence
AATAAAVVAEEDTELRDLLVQTLENSGVLNRIKAELRAAVFLALEEQEKVENKTPLVNESLKKFLNTKDGRLVASLVAEFLQFFNLDFTLAVFQPETSTLQGLEGRENLARDLGIIEAEGTVGGPLLLEVIRRCQQKEKGPTTGEGALDLSDVHSPPKSPEGKTSAQTTPSKKANDEANQSDTSVSLSEPKSKSSLHLLSHETKIGSFLSNRTLDGKDKAGLCPDEDDMEGDSFFDDPIPKPEKTYGLRKEPRKQAGSLASLSDAPPLKSGLSSLAGAPSLKDSESKRGNTVLKDLKLISDKIGSLGLGTGEDDDYVDDFNSTSHRSEKSEISIGEEIEEDLSVEIDDINTSDKLDDLTQDLTVSQLSDVADYLEDVA
-
Predicted Molecular Mass
68.6 kDa
-
Molecular Weight
Approximately 69 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Purity
≥ 85%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
