1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. FGF Family
  4. FGFR1OP Protein, Human (sf9, His-GST)

FGFR1OP is critical for microtubule dynamics, anchoring microtubules at centrosomes, which is critical for cell organization. It plays an integral role in cilia formation and helps control the complex process of cilia formation. FGFR1OP Protein, Human (sf9, His-GST) is the recombinant human-derived FGFR1OP protein, expressed by Sf9 insect cells , with N-His, N-GST labeled tag.

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

사이즈 재고
50 μg   견적 받기  
100 μg   견적 받기  

* 장바구니에 담기 전 물품의 수량을 선택해 주십시오.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • 제품 설명

제품 설명

FGFR1OP is critical for microtubule dynamics, anchoring microtubules at centrosomes, which is critical for cell organization. It plays an integral role in cilia formation and helps control the complex process of cilia formation. FGFR1OP Protein, Human (sf9, His-GST) is the recombinant human-derived FGFR1OP protein, expressed by Sf9 insect cells , with N-His, N-GST labeled tag.

Background

FGFR1OP plays a crucial role in microtubule dynamics by serving as an essential factor for anchoring microtubules to the centrosomes, emphasizing its significance in cellular organization. Furthermore, FGFR1OP is indispensable for ciliation, contributing to the intricate processes that govern the formation and maintenance of cellular cilia. Structurally, FGFR1OP forms homodimers and is a component of a ternary complex, along with CEP350 and MAPRE1, highlighting its participation in molecular interactions critical for centrosomal and microtubule-associated functions. The direct interactions of FGFR1OP with CEP350 and MAPRE1 underscore its role in coordinating the assembly and organization of cellular structures. Additionally, FGFR1OP engages with CEP19, further expanding its network of interactions and implicating its involvement in various cellular processes.

Species

Human

Source

Sf9 insect cells

Tag

N-His;N-GST

Accession

O95684-2 (A2-A379)

Gene ID
Molecular Construction
N-term
His-GST
FGFR1OP (A2-A379)
Accession # O95684-2
C-term
Protein Length

Full Length of Isoform-2 Mature Protein

Synonyms
Centrosomal protein 43; FGFR1 oncogene partner; CEP43; FOP
AA Sequence

AATAAAVVAEEDTELRDLLVQTLENSGVLNRIKAELRAAVFLALEEQEKVENKTPLVNESLKKFLNTKDGRLVASLVAEFLQFFNLDFTLAVFQPETSTLQGLEGRENLARDLGIIEAEGTVGGPLLLEVIRRCQQKEKGPTTGEGALDLSDVHSPPKSPEGKTSAQTTPSKKANDEANQSDTSVSLSEPKSKSSLHLLSHETKIGSFLSNRTLDGKDKAGLCPDEDDMEGDSFFDDPIPKPEKTYGLRKEPRKQAGSLASLSDAPPLKSGLSSLAGAPSLKDSESKRGNTVLKDLKLISDKIGSLGLGTGEDDDYVDDFNSTSHRSEKSEISIGEEIEEDLSVEIDDINTSDKLDDLTQDLTVSQLSDVADYLEDVA

Predicted Molecular Mass
68.6 kDa
분자량

Approximately 69 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.

Purity

≥ 85%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

각종 서류

FGFR1OP Protein, Human (sf9, His-GST) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

최근 본 상품:

온라인 문의

Your information is safe with us. * Required Fields.

FGFR1OP Protein, Human (sf9, His-GST)

 

Requested Quantity *

고객명 *

 

호칭

메일주소 *

 

전화번호 *

Department

 

회사명 *

City

Country or Region *

     

비고

대량구매 문의

Inquiry Information

상품명:
FGFR1OP Protein, Human (sf9, His-GST)
Cat. No.:
HY-P76927
수량:
MCE Japan Authorized Agent: