FGFR1OP Protein, Human (sf9, His-GST)

FGFR1OP is critical for microtubule dynamics, anchoring microtubules at centrosomes, which is critical for cell organization. It plays an integral role in cilia formation and helps control the complex process of cilia formation. FGFR1OP Protein, Human (sf9, His-GST) is the recombinant human-derived FGFR1OP protein, expressed by Sf9 insect cells , with N-His, N-GST labeled tag.

FGFR1OP plays a crucial role in microtubule dynamics by serving as an essential factor for anchoring microtubules to the centrosomes, emphasizing its significance in cellular organization. Furthermore, FGFR1OP is indispensable for ciliation, contributing to the intricate processes that govern the formation and maintenance of cellular cilia. Structurally, FGFR1OP forms homodimers and is a component of a ternary complex, along with CEP350 and MAPRE1, highlighting its participation in molecular interactions critical for centrosomal and microtubule-associated functions. The direct interactions of FGFR1OP with CEP350 and MAPRE1 underscore its role in coordinating the assembly and organization of cellular structures. Additionally, FGFR1OP engages with CEP19, further expanding its network of interactions and implicating its involvement in various cellular processes.

Human

Sf9 insect cells

N-His;N-GST

O95684-2 (A2-A379)

11116  [NCBI]

Full Length of Isoform-2 Mature Protein

AATAAAVVAEEDTELRDLLVQTLENSGVLNRIKAELRAAVFLALEEQEKVENKTPLVNESLKKFLNTKDGRLVASLVAEFLQFFNLDFTLAVFQPETSTLQGLEGRENLARDLGIIEAEGTVGGPLLLEVIRRCQQKEKGPTTGEGALDLSDVHSPPKSPEGKTSAQTTPSKKANDEANQSDTSVSLSEPKSKSSLHLLSHETKIGSFLSNRTLDGKDKAGLCPDEDDMEGDSFFDDPIPKPEKTYGLRKEPRKQAGSLASLSDAPPLKSGLSSLAGAPSLKDSESKRGNTVLKDLKLISDKIGSLGLGTGEDDDYVDDFNSTSHRSEKSEISIGEEIEEDLSVEIDDINTSDKLDDLTQDLTVSQLSDVADYLEDVA

Approximately 69 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.

≥ 85%, as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.