FKBP7 Protein, Human (199a.a, HEK293, His)

The FKBP7 protein is a peptidyl prolyl cis-trans isomerase (PPIase) that significantly accelerates protein folding, especially in the complexities of protein synthesis. Utilizing its enzymatic abilities, FKBP7 plays a crucial role in coordinating timely conformational changes to achieve correct protein folding and maturation. FKBP7 Protein, Human (199a.a, HEK293, His) is the recombinant human-derived FKBP7 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of FKBP7 Protein, Human (199a.a, HEK293, His) is 199 a.a., with molecular weight of 25-32 kDa.

FKBP7 Protein stands out as a peptidyl-prolyl cis-trans isomerase (PPIase) that plays a pivotal role in expediting the folding of proteins, particularly during the intricate process of protein synthesis. Harnessing its enzymatic activity, FKBP7 contributes to the dynamic and timely conformational changes essential for the correct folding and maturation of proteins. As a member of the PPIase family, FKBP7 is adept at catalyzing the cis-trans isomerization of proline imidic peptide bonds, influencing the structural dynamics of nascent or misfolded polypeptides. This functional attribute underscores the protein's significance in maintaining cellular protein homeostasis and underscores its potential impact on cellular physiology. Further investigations are warranted to unravel the specific molecular mechanisms through which FKBP7 actively participates in the intricate choreography of protein folding during synthesis.

Human

HEK293

C-6*His

Q9Y680 (Q24-L222)

51661  [NCBI]

QRQKKEESTEEVKIEVLHRPENCSKTSKKGDLLNAHYDGYLAKDGSKFYCSRTQNEGHPKWFVLGVGQVIKGLDIAMTDMCPGEKRKVVIPPSFAYGKEGYAEGKIPPDATLIFEIELYAVTKGPRSIETFKQIDMDNDRQLSKAEINLYLQREFEKDEKPRDKSYQDAVLEDIFKKNDHDGDGFISPKEYNVYQHDEL

25-32 kDa

Greater than 95% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.