FOLR2 Protein, Human (HEK293, His)

Customer Review

Based on 1 Customer Validation

FOLR2 Protein binds folate, enabling the transport of 5-methyltetrahydrofolate into cells with high affinity under neutral pH. Upon endocytosis, exposure to slightly acidic pH induces a conformational change, substantially reducing FOLR2's folate affinity and releasing it from the receptor. FOLR2 Protein, Human (HEK293, His) is the recombinant human-derived FOLR2 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

FOLR2 Protein binds folate, enabling the transport of 5-methyltetrahydrofolate into cells with high affinity under neutral pH. Upon endocytosis, exposure to slightly acidic pH induces a conformational change, substantially reducing FOLR2's folate affinity and releasing it from the receptor. FOLR2 Protein, Human (HEK293, His) is the recombinant human-derived FOLR2 protein, expressed by HEK293 , with C-His labeled tag.

Background

The FOLR2 protein binds to folate and reduced folic acid derivatives, facilitating the transport of 5-methyltetrahydrofolate and folate analogs into the intracellular space. It exhibits a high affinity for folate and folic acid analogs under neutral pH conditions. However, upon receptor endocytosis, exposure to a slightly acidic pH triggers a conformational change in FOLR2, resulting in a significant reduction in its affinity for folates and subsequent release from the receptor.

Verified Bioactivity

Measured by its binding ability in a functional ELISA. When Folic acid -BSA conjugate is coated at 5 μg/mL (100 μL/well), the concentration of rhFOLR2 that produces 50% of the optimal binding response is found to be approximately 0.983 nM.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - ELISA

    Bioactivity - ELISA

    Measured by its binding ability in a functional ELISA. When Folic acid -BSA conjugate is coated at 5 μg/mL (100 μL/well), the concentration of rhFOLR2 that produces 50% of the optimal binding response is found to be approximately 0.983 nM.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • FOLR2 (T17-H228)
      Accession # P14207
    • His
    • C-term
  • Protein Length

    Full Length of Folate receptor beta Chain

  • Synonyms

    FOLR2; FOLR2 Protein; Folate Receptor Beta; BETA-HFR; Folate Receptor, Fetal/Placental; FBP/PL-1; Placental Folate-Binding Protein; FR-BETA; Folate Receptor 2 (Fetal); FR-Beta; FBP; FRbeta; Folate-Binding Protein, Fetal/Placental; FR-P3; Folate Receptor A

  • AA Sequence

    TMCSAQDRTDLLNVCMDAKHHKTKPGPEDKLHDQCSPWKKNACCTASTSQELHKDTSRLYNFNWDHCGKMEPACKRHFIQDTCLYECSPNLGPWIQQVNQSWRKERFLDVPLCKEDCQRWWEDCHTSHTCKSNWHRGWDWTSGVNKCPAGALCRTFESYFPTPAALCEGLWSHSYKVSNYSRGSGRCIQMWFDSAQGNPNEEVARFYAAAMH

  • Molecular Weight

    Approximately 30-35 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00