FOLR1 Protein, Human (HEK293, His)
Based on 1 Customer Validation
The FOLR1 protein is an important mediator of folate uptake, binding to folate and promoting the delivery of 5-methyltetrahydrofolate into cells. Studies show high affinity at neutral pH. FOLR1 Protein, Human (HEK293, His) is the recombinant human-derived FOLR1 protein, expressed by HEK293 , with C-His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The FOLR1 protein is an important mediator of folate uptake, binding to folate and promoting the delivery of 5-methyltetrahydrofolate into cells. Studies show high affinity at neutral pH. FOLR1 Protein, Human (HEK293, His) is the recombinant human-derived FOLR1 protein, expressed by HEK293 , with C-His labeled tag.
Background
The FOLR1 protein functions as a key mediator in folate uptake, binding to folate and reduced folic acid derivatives to facilitate the delivery of 5-methyltetrahydrofolate and folate analogs into the cell interior. This process is characterized by a high affinity for folate and folic acid analogs at neutral pH, as evidenced by various studies. Notably, exposure to a slightly acidic pH following receptor endocytosis induces a conformational change that significantly reduces its affinity for folates, facilitating their release. Beyond its role in folate transport, FOLR1 is essential for normal embryonic development and proper cell proliferation, underlining its significance in fundamental cellular processes.
Verified Bioactivity
1.Measured by its binding ability in a functional ELISA. Immobilized FOLR1 at 1 μg/mL can bind Anti-FOLR1 antibody, Mouse IgG1, the EC50 of human FOLR1 protein is ≤9.719 ng/mL, corresponding to a specific activity is ≥1.029×105 units/mg.
2. Loaded Luveltamab (HY-P990687) on AHC2 biosensor, can bind FOLR1 Protein, Human (HEK293, His) with an affinity constant of 3.314E-09 M as determined in BLI assay.
3.Loaded Anti-Human FOLR1 Antibody on Pro-A Biosensor, can bind Recombinant Human FOLR1 with an affinity constant of 0.103 µM as determined in BLI assay.
4.Loaded Torvutatug (HY-P991164) on Pro-A biosensor, can bind FOLR1 Protein, Human (HEK293, His) with an affinity constant of 2.582E-08 M as determined in BLI assay.
5.Measured by its binding ability in a functional ELISA. Immobilized Human FOLR1-His at 1 μg/mL (100 μL/well)can bind Anti-Human FOLR1 mAb. The ED50 for this effect is ≤20 ng/mL.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
-
Bioactivity - ELISA
Bioactivity - ELISA
-
Bioactivity - BLI
Bioactivity - BLI
-
Bioactivity - BLI
Bioactivity - BLI
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-His
-
Accession
P15328 (R25-S234)
-
Molecular Construction
-
N-term
-
FOLR1 (R25-S234)
Accession # P15328 -
His
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
FOLR1; KB Cells FBP; Prev. FOLR; FBP; Ovarian Tumor-Associated Antigen MOv18; Folate Binding Protein; Adult Folate-Binding Protein; FRalpha; Folate Receptor 1 (Adult); NCFTD; Folate Receptor, Adult; FRα; Folate Receptor 1; FRA; Folate Receptor Alpha; FR-Alpha
-
AA Sequence
RIAWARTELLNVCMNAKHHKEKPGPEDKLHEQCRPWRKNACCSTNTSQEAHKDVSYLYRFNWNHCGEMAPACKRHFIQDTCLYECSPNLGPWIQQVDQSWRKERVLNVPLCKEDCEQWWEDCRTSYTCKSNWHKGWNWTSGFNKCAVGAACQPFHFYFPTPTVLCNEIWTHSYKVSNYSRGSGRCIQMWFDPAQGNPNEEVARFYAAAMS
-
Molecular Weight
Approximately 28-38 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
1.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
2.Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.
Please refer to the lot-specific COA for specific buffer information.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (238 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
