Copy Link Print Information

Frizzled-4/CD344 Protein, Human (HEK293, His)

Customer Review

Based on 1 Customer Validation

The Frizzled-4/CD344 protein is a receptor for Wnt proteins and is associated with the classical β-catenin pathway, activating disheveled proteins, inhibiting GSK-3 kinase, and triggering Wnt target genes. In retinal vascularization, it acts as a receptor for Wnt proteins and Norrin (NDP), stimulating β-catenin accumulation and LEF/TCF-mediated transcription. Frizzled-4/CD344 Protein, Human (HEK293, His) is the recombinant human-derived Frizzled-4/CD344 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for Frizzled-4/CD344 Protein, Human (HEK293, His)
  • Experimental Validation Results for Frizzled-4/CD344 Protein, Human (HEK293, His)
  • Frizzled-4/CD344 Protein, Human (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

The Frizzled-4/CD344 protein is a receptor for Wnt proteins and is associated with the classical β-catenin pathway, activating disheveled proteins, inhibiting GSK-3 kinase, and triggering Wnt target genes. In retinal vascularization, it acts as a receptor for Wnt proteins and Norrin (NDP), stimulating β-catenin accumulation and LEF/TCF-mediated transcription. Frizzled-4/CD344 Protein, Human (HEK293, His) is the recombinant human-derived Frizzled-4/CD344 protein, expressed by HEK293 , with C-His labeled tag.

Background

Frizzled-4/CD344 Protein serves as a receptor for Wnt proteins, particularly associated with the canonical beta-catenin signaling pathway, involving the activation of disheveled proteins, inhibition of GSK-3 kinase, nuclear accumulation of beta-catenin, and subsequent activation of Wnt target genes. In the context of retinal vascularization, Frizzled-4 plays a pivotal role by acting as a receptor for both Wnt proteins and norrin (NDP), facilitating beta-catenin accumulation and stimulation of LEF/TCF-mediated transcriptional programs. Although a secondary signaling pathway, featuring PKC and calcium fluxes, has been observed in some family members, its integration with the canonical pathway, particularly in the context of Wnt-mediated inactivation of GSK-3 kinase, remains uncertain. Frizzled-4's involvement in tissue morphogenesis and intercellular transmission of polarity information is suggested, with interactions observed with MAGI3, NDP, TSKU, and glypican GPC3, highlighting its intricate role in cellular processes and signaling cascades.

Verified Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized Human Frizzled-4, at 0.1 μg/mL (100 μL/well) can bind Wnt-5a. The ED50 for this effect is 26.59 ng/mL.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - ELISA

    Bioactivity - ELISA

    Measured by its binding ability in a functional ELISA. Immobilized Human Frizzled-4, at 0.1 μg/mL (100 μL/well) can bind Wnt-5a. The ED50 for this effect is 26.59 ng/mL.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-His
  • Accession

    Q9ULV1 (F37-E180)

  • Gene ID
    8322  [NCBI]
  • Molecular Construction
    • N-term
    • FZD4 (F37-E180)
      Accession # Q9ULV1
    • His
    • C-term
  • Protein Length

    Partial Extracellular Domain

  • Synonyms

    FZD4; Frizzled Homolog 4 (Drosophila); Prev. EVR1; Exudative Vitreoretinopathy 1; CD344; WNT Receptor Frizzled-4; Frizzled 4, Seven Transmembrane Spanning Receptor; Frizzled Homolog 4; Frizzled Family Receptor 4; CD344 Antigen; Frizzled-4; FZD4S; Fz-4; FE

  • AA Sequence

    FGDEEERRCDPIRISMCQNLGYNVTKMPNLVGHELQTDAELQLTTFTPLIQYGCSSQLQFFLCSVYVPMCTEKINIPIGPCGGMCLSVKRRCEPVLKEFGFAWPESLNCSKFPPQNDHNHMCMEGPGDEEVPLPHKTPIQPGEE

  • Molecular Weight

    Approximately 22-25 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured by its binding ability in a functional ELISA. Immobilized Human Frizzled-4, at 0.1 μg/mL (100 μL/well) can bind Wnt-5a. The ED50 for this effect is 26.59 ng/mL.

  • Frizzled-4/CD344 Protein, Human (HEK293, His) Product Image
    1/16
  • Experimental Validation Results for Frizzled-4/CD344 Protein, Human (HEK293, His)
  • Experimental Validation Results for Frizzled-4/CD344 Protein, Human (HEK293, His)
  • Frizzled-4/CD344 Protein, Human (HEK293, His) Product Image