Frizzled-7 Protein, Human (HEK293, hFc)
GIP Protein is a protein involved in the regulation of glucose homeostasis and insulin secretion. It plays a crucial role in modulating pancreatic beta-cell function and glucose metabolism. Dysregulation of GIP Protein has been associated with various diseases, including type 2 diabetes and obesity. Targeting GIP Protein may offer potential therapeutic interventions in these conditions by improving glucose regulation and insulin sensitivity. Frizzled-7 Protein, Human (HEK293, hFc) is the recombinant human-derived Frizzled-7 protein, expressed by HEK293 , with C-hFc labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
GIP Protein is a protein involved in the regulation of glucose homeostasis and insulin secretion. It plays a crucial role in modulating pancreatic beta-cell function and glucose metabolism. Dysregulation of GIP Protein has been associated with various diseases, including type 2 diabetes and obesity. Targeting GIP Protein may offer potential therapeutic interventions in these conditions by improving glucose regulation and insulin sensitivity. Frizzled-7 Protein, Human (HEK293, hFc) is the recombinant human-derived Frizzled-7 protein, expressed by HEK293 , with C-hFc labeled tag.
Background
The Frizzled-7 (FZD7) Protein, a member of the 'frizzled' gene family, encodes a 7-transmembrane domain receptor for Wnt signaling proteins. The FZD7 protein structure includes an N-terminal signal sequence, a cysteine-rich extracellular domain with 10 cysteine residues characteristic of Fz family members, 7 putative transmembrane domains, and an intracellular C-terminal tail featuring a PDZ domain-binding motif. The expression of the FZD7 gene is implicated in potentially downregulating APC function and enhancing beta-catenin-mediated signals, particularly observed in poorly differentiated human esophageal carcinomas. This highlights FZD7's role in modulating critical cellular signaling pathways, particularly in the context of cancer progression.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-hFc
-
Accession
O75084/NP_003498 (Q33-L185)
-
Gene ID8324
-
Molecular Construction
-
N-term
-
Frizzled-7 (Q33-L185)
Accession # NP_003498 -
hFc
-
C-term
-
-
Protein Length
Partial Extracellular Domain
-
Synonyms
FZD7; Fz-7; Frizzled Class Receptor 7; HFz7; FzE3; Frizzled, Drosophila, Homolog Of, 7; Frizzled-7; Frizzled (Drosophila) Homolog 7; Frizzled 7, Seven Transmembrane Spanning Receptor; Frizzled Homolog 7 (Drosophila); Frizzled Family Receptor 7; Frizzled H
-
AA Sequence
QPYHGEKGISVPDHGFCQPISIPLCTDIAYNQTILPNLLGHTNQEDAGLEVHQFYPLVKVQCSPELRFFLCSMYAPVCTVLDQAIPPCRSLCERARQGCEALMNKFGFQWPERLRCENFPVHGAGEICVGQNTSDGSGGPGGGPTAYPTAPYL
-
Predicted Molecular Mass
43.4 kDa
-
Molecular Weight
Approximately 55 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 200 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
