Frizzled-7 Protein, Human (HEK293, hFc)

GIP Protein is a protein involved in the regulation of glucose homeostasis and insulin secretion. It plays a crucial role in modulating pancreatic beta-cell function and glucose metabolism. Dysregulation of GIP Protein has been associated with various diseases, including type 2 diabetes and obesity. Targeting GIP Protein may offer potential therapeutic interventions in these conditions by improving glucose regulation and insulin sensitivity. Frizzled-7 Protein, Human (HEK293, hFc) is the recombinant human-derived Frizzled-7 protein, expressed by HEK293 , with C-hFc labeled tag.

The Frizzled-7 (FZD7) Protein, a member of the 'frizzled' gene family, encodes a 7-transmembrane domain receptor for Wnt signaling proteins. The FZD7 protein structure includes an N-terminal signal sequence, a cysteine-rich extracellular domain with 10 cysteine residues characteristic of Fz family members, 7 putative transmembrane domains, and an intracellular C-terminal tail featuring a PDZ domain-binding motif. The expression of the FZD7 gene is implicated in potentially downregulating APC function and enhancing beta-catenin-mediated signals, particularly observed in poorly differentiated human esophageal carcinomas. This highlights FZD7's role in modulating critical cellular signaling pathways, particularly in the context of cancer progression.

Human

HEK293

C-hFc

O75084/NP_003498 (Q33-L185)

8324

Partial

QPYHGEKGISVPDHGFCQPISIPLCTDIAYNQTILPNLLGHTNQEDAGLEVHQFYPLVKVQCSPELRFFLCSMYAPVCTVLDQAIPPCRSLCERARQGCEALMNKFGFQWPERLRCENFPVHGAGEICVGQNTSDGSGGPGGGPTAYPTAPYL

Approximately 50-60 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

≥ 95%, as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.