1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. TGF-beta Superfamily Neurotrophic Factors
  4. Growth Differentiation Factor GDNF family
  5. Growth Differentiation Factor 15 (GDF-15)
  6. GDF-15 Protein, Cynomolgus (His)

GDF-15 Protein, a key regulator of food intake and energy balance, binds to its receptor GFRAL, activating neurons in the brainstem and forming an 'emergency circuit' for feeding responses during stress. Additionally, GDF-15 inhibits growth hormone signaling on hepatocytes, existing as a disulfide-linked homodimer. Interacting with GFRAL, it acts as a ligand, mediating GDF15 internalization and cellular signaling through RET. GDF-15 Protein, Cynomolgus (His) is the recombinant cynomolgus-derived GDF-15 protein, expressed by E. coli , with N-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock
20 μg Ask For Quote & Lead Time
50 μg Ask For Quote & Lead Time
100 μg Ask For Quote & Lead Time

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

GDF-15 Protein, a key regulator of food intake and energy balance, binds to its receptor GFRAL, activating neurons in the brainstem and forming an 'emergency circuit' for feeding responses during stress. Additionally, GDF-15 inhibits growth hormone signaling on hepatocytes, existing as a disulfide-linked homodimer. Interacting with GFRAL, it acts as a ligand, mediating GDF15 internalization and cellular signaling through RET. GDF-15 Protein, Cynomolgus (His) is the recombinant cynomolgus-derived GDF-15 protein, expressed by E. coli , with N-His labeled tag.

Background

GDF-15 Protein is a key regulator of food intake, energy expenditure, and body weight in response to metabolic and toxin-induced stresses. It exerts its effects by binding to its receptor, GFRAL, and activating GFRAL-expressing neurons found in the area postrema and nucleus tractus solitarius of the brainstem. This activation subsequently leads to the activation of neurons within the parabrachial nucleus and central amygdala, which form part of the 'emergency circuit' responsible for shaping feeding responses during stressful conditions. Furthermore, GDF-15 Protein inhibits growth hormone signaling on hepatocytes and exists as a homodimer that is disulfide-linked. It also interacts with GFRAL, acting as a ligand to mediate GDF15 internalization and cellular signaling through its interaction with RET.

Species

Cynomolgus

Source

E. coli

Tag

N-8*His

Accession

G7PWZ3 (R193-V308)

Gene ID
Molecular Construction
N-term
8*His
GDF-15 (R193-V308)
Accession # G7PWZ3
C-term
Protein Length

Full Length of Mature Protein

Synonyms
GDF-15; MIC-1; NAG-1; PDF; PLAB; PTGFB; GDF15; MIC1; RG-1; Placental TGF-beta; PTGF-beta; PTGFBPTGF-beta; Placental TGF-β; PTGF-β; PTGFBPTGF-β
AA Sequence

RRARARNGDRCPLGPGRCCRLHTVHASLEDLGWADWVLSPREVQVTMCIGACPSQFREANMHAQIKMNLHRLKPDTVPAPCCVPASYNPMVLIQKTDTGVSLQTYDDLLAKDCHCV

Predicted Molecular Mass
14.2 kDa
Molecular Weight

Approximately 15-18 kDa, based on SDS-PAGE under reducing conditions.

Purity

≥ 95%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

GDF-15 Protein, Cynomolgus (His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
GDF-15 Protein, Cynomolgus (His)
Cat. No.:
HY-P700866
Quantity:
MCE Japan Authorized Agent: