GDF-15 Protein, Cynomolgus (His)

GDF-15 Protein, a key regulator of food intake and energy balance, binds to its receptor GFRAL, activating neurons in the brainstem and forming an 'emergency circuit' for feeding responses during stress. Additionally, GDF-15 inhibits growth hormone signaling on hepatocytes, existing as a disulfide-linked homodimer. Interacting with GFRAL, it acts as a ligand, mediating GDF15 internalization and cellular signaling through RET. GDF-15 Protein, Cynomolgus (His) is the recombinant cynomolgus-derived GDF-15 protein, expressed by E. coli , with N-His labeled tag.

GDF-15 Protein is a key regulator of food intake, energy expenditure, and body weight in response to metabolic and toxin-induced stresses. It exerts its effects by binding to its receptor, GFRAL, and activating GFRAL-expressing neurons found in the area postrema and nucleus tractus solitarius of the brainstem. This activation subsequently leads to the activation of neurons within the parabrachial nucleus and central amygdala, which form part of the 'emergency circuit' responsible for shaping feeding responses during stressful conditions. Furthermore, GDF-15 Protein inhibits growth hormone signaling on hepatocytes and exists as a homodimer that is disulfide-linked. It also interacts with GFRAL, acting as a ligand to mediate GDF15 internalization and cellular signaling through its interaction with RET.

Cynomolgus

E. coli

N-8*His

G7PWZ3 (R193-V308)

102117226  [NCBI]

Full Length of Mature Protein

RRARARNGDRCPLGPGRCCRLHTVHASLEDLGWADWVLSPREVQVTMCIGACPSQFREANMHAQIKMNLHRLKPDTVPAPCCVPASYNPMVLIQKTDTGVSLQTYDDLLAKDCHCV

Approximately 15-18 kDa,based on SDS-PAGE under reducing conditions.

≥ 95%, as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.