GDF-15 Protein, Cynomolgus (His)
Based on 1 Customer Validation
GDF-15 Protein, a key regulator of food intake and energy balance, binds to its receptor GFRAL, activating neurons in the brainstem and forming an 'emergency circuit' for feeding responses during stress. Additionally, GDF-15 inhibits growth hormone signaling on hepatocytes, existing as a disulfide-linked homodimer. Interacting with GFRAL, it acts as a ligand, mediating GDF15 internalization and cellular signaling through RET. GDF-15 Protein, Cynomolgus (His) is the recombinant cynomolgus-derived GDF-15 protein, expressed by E. coli , with N-His labeled tag.
- Species: Cynomolgus
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
GDF-15 Protein, a key regulator of food intake and energy balance, binds to its receptor GFRAL, activating neurons in the brainstem and forming an 'emergency circuit' for feeding responses during stress. Additionally, GDF-15 inhibits growth hormone signaling on hepatocytes, existing as a disulfide-linked homodimer. Interacting with GFRAL, it acts as a ligand, mediating GDF15 internalization and cellular signaling through RET. GDF-15 Protein, Cynomolgus (His) is the recombinant cynomolgus-derived GDF-15 protein, expressed by E. coli , with N-His labeled tag.
Background
GDF-15 Protein is a key regulator of food intake, energy expenditure, and body weight in response to metabolic and toxin-induced stresses. It exerts its effects by binding to its receptor, GFRAL, and activating GFRAL-expressing neurons found in the area postrema and nucleus tractus solitarius of the brainstem. This activation subsequently leads to the activation of neurons within the parabrachial nucleus and central amygdala, which form part of the 'emergency circuit' responsible for shaping feeding responses during stressful conditions. Furthermore, GDF-15 Protein inhibits growth hormone signaling on hepatocytes and exists as a homodimer that is disulfide-linked. It also interacts with GFRAL, acting as a ligand to mediate GDF15 internalization and cellular signaling through its interaction with RET.
Verified Bioactivity
1. Immobilized Cynomolgus GDF15, His Tag at 5μg/ml (100μl/well) on the plate. Dose response curve for Biotinylated Cynomolgus GFRAL, His Tag with the EC50 of 30-60 ng/ml determined by ELISA.
2. Immobilized Cynomolgus GDF15, His Tag at 0.2μg/ml (100μl/well) on the plate. Dose response curve for Anti-GDF15 Antibody, hFc Tag with the EC50 of 6.1 ng/ml determined by ELISA.
Technical Parameters
-
Species Cynomolgus
-
Source E. coli
-
Tag N-8*His
-
Accession
G7PWZ3 (R193-V308)
-
Molecular Construction
-
N-term
-
8*His
-
GDF-15 (R193-V308)
Accession # G7PWZ3 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
GDF15; Placental Bone Morphogenetic Protein; Growth Differentiation Factor 15; Macrophage Inhibitory Cytokine 1; MIC-1; NSAID-Activated Gene 1 Protein; NAG-1; NSAID-Regulated Gene 1 Protein; PTGFB; Placental TGF-Beta; PLAB; GDF-15; MIC1; NRG-1; PDF; NSAID
-
AA Sequence
RRARARNGDRCPLGPGRCCRLHTVHASLEDLGWADWVLSPREVQVTMCIGACPSQFREANMHAQIKMNLHRLKPDTVPAPCCVPASYNPMVLIQKTDTGVSLQTYDDLLAKDCHCV
-
Predicted Molecular Mass
14.2 kDa
-
Molecular Weight
Approximately 15-18 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 50mM HAc, pH 2.9. Normally 8% trehalose is added as protectant before lyophilization.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in 50mM HAc, pH 2.9.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
