GIP Protein, Human (HEK293, hFc)

The GIP protein is a member of the glucagon superfamily, an important incretin hormone that stimulates pancreatic beta cells to secrete insulin in response to food intake. Through its G protein-coupled receptor, it activates adenylyl cyclase and other signal transduction pathways. GIP Protein, Human (HEK293, hFc) is the recombinant human-derived GIP protein, expressed by HEK293 , with C-hFc labeled tag.

The GIP Protein, classified within the glucagon superfamily, serves as an incretin hormone crucial for glucose homeostasis. Its significance lies in being a potent stimulator of insulin secretion from pancreatic beta-cells in response to food ingestion and nutrient absorption. This stimulation occurs through the activation of its G protein-coupled receptor, triggering adenylyl cyclase and other signal transduction pathways. While GIP is a relatively poor inhibitor of gastric acid secretion, its primary role in insulin regulation positions it as a key player in metabolic processes. The gene exhibits biased expression, with noteworthy levels detected in the duodenum (RPKM 96.0) and small intestine (RPKM 33.9), emphasizing its involvement in digestive and metabolic functions within the gastrointestinal tract.

1.Immobilized Human GIP at 0.5 μg/mL (100 μL/well) can bind Anti-GIP Antibody, the ED₅₀ for this effect is 30-100 ng/mL.
2.Immobilized Human GIP at 2 μg/mL (100 μL/well) can bind Anti-GIP Antibody, The ED₅₀ for this effect is 39.44 ng/mL.

Human

HEK293

C-hFc

NP_004114.1 (E22-Q93)

2695  [NCBI]

Partial

EKKEGHFSALPSLPVGSHAKVSSPQPRGPRYAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ

Approximately 37-48 kDa

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.