GMP IFN-gamma Protein, Human (HEK293)

IFN-gamma Protein is a cytokine belonging to the interferon family, secreted by activated immune cells such as T cells and NK cells. IFN-gamma Protein plays a key role in the immune system, exerting activities including regulating immune responses, antiviral effects, and antitumor effects. GMP IFN-gamma Protein, Human (HEK293) is a recombinant GMP-grade IFN-gamma protein expressed by HEK293, untagged but glycosylated^[1][2][3].

IFN-gamma is a cytokine with immunomodulatory, antitumor, and antiviral properties. IFN-gamma can activate macrophages and NK cells, regulate T-cell differentiation, and participate in inflammatory responses. IFN-gamma induces antiviral proteins to inhibit viral replication and enhances the immune recognition of infected cells. IFN-gamma also exerts antitumor effects by suppressing tumor cell proliferation, activating immune cells, and inhibiting tumor angiogenesis. Meanwhile, IFN-gamma promotes the expression of MHC molecules to improve the efficiency of immune cells in recognizing pathogens and abnormal cells. Additionally, IFN-gamma is involved in regulating the differentiation and maturation of bone marrow hematopoietic stem cells^[1][2][3].

IFN-gamma Protein (Human; 100 ng/mL; 72 h) induces cell death and G₂ cell cycle arrest in the ovarian cancer cell line PEO1^[4].
IFN-gamma Protein (Human; 0.1-1 nM) induces multinuclear giant cell formation and enhances H₂O₂ production and lysosomal enzyme activity in human monocyte cultures^[5].
IFN-gamma Protein (Human; 1-100 ng/mL; 4-18 h) inhibits IL-10 mRNA and protein expression and dose-dependently upregulates TNF-α transcript and protein levels in LPS-stimulated human monocytes^[6].

The specific activity is >2×10⁷ IU/mg.

Human

HEK293

Tag Free

P01579 (Q24-Q166)

3458  [NCBI]

Full Length of Mature Protein

QDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRGRRASQ

16&18&25 kDa

≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 4% Mannitol, 2% Sucrose, 0.02% Tween80, pH 7.4.

<0.01 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in injection water.

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Kursunel MA, et al. The untold story of IFN-γ in cancer biology. Cytokine Growth Factor Rev. 2016 Oct;31:73-81.  [Content Brief]

  [2]. Chesler DA, et al. The role of IFN-gamma in immune responses to viral infections of the central nervous system. Cytokine Growth Factor Rev. 2002 Dec;13(6):441-54.  [Content Brief]

  [3]. Goedhart M, et al. Interferon-Gamma Impairs Maintenance and Alters Hematopoietic Support of Bone Marrow Mesenchymal Stromal Cells. Stem Cells Dev. 2018 May 1;27(9):579-589.  [Content Brief]

  [4]. Razaghi A, et al. Improved therapeutic efficacy of mammalian expressed-recombinant interferon gamma against ovarian cancer cells. Exp Cell Res. 2017 Oct 1;359(1):20-29.  [Content Brief]

  [5]. Weinberg JB, et al. Recombinant human gamma-interferon induces human monocyte polykaryon formation. Proc Natl Acad Sci U S A. 1984 Jul;81(14):4554-7.  [Content Brief]

  [6]. Donnelly RP, et al. Inhibition of IL-10 expression by IFN-gamma up-regulates transcription of TNF-alpha in human monocytes. J Immunol. 1995 Aug 1;155(3):1420-7.  [Content Brief]