GMP IFN-gamma Protein, Human (HEK293)
Based on 1 publication(s) in Google Scholar
IFN-gamma Protein is a cytokine belonging to the interferon family, secreted by activated immune cells such as T cells and NK cells. IFN-gamma Protein plays a key role in the immune system, exerting activities including regulating immune responses, antiviral effects, and antitumor effects. GMP IFN-gamma Protein, Human (HEK293) is a recombinant GMP-grade IFN-gamma protein expressed by HEK293, untagged but glycosylated.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- References
- Help & FAQs
Biological Activity
Description
IFN-gamma Protein is a cytokine belonging to the interferon family, secreted by activated immune cells such as T cells and NK cells. IFN-gamma Protein plays a key role in the immune system, exerting activities including regulating immune responses, antiviral effects, and antitumor effects. GMP IFN-gamma Protein, Human (HEK293) is a recombinant GMP-grade IFN-gamma protein expressed by HEK293, untagged but glycosylated[1][2][3].
Background
IFN-gamma is a cytokine with immunomodulatory, antitumor, and antiviral properties. IFN-gamma can activate macrophages and NK cells, regulate T-cell differentiation, and participate in inflammatory responses. IFN-gamma induces antiviral proteins to inhibit viral replication and enhances the immune recognition of infected cells. IFN-gamma also exerts antitumor effects by suppressing tumor cell proliferation, activating immune cells, and inhibiting tumor angiogenesis. Meanwhile, IFN-gamma promotes the expression of MHC molecules to improve the efficiency of immune cells in recognizing pathogens and abnormal cells. Additionally, IFN-gamma is involved in regulating the differentiation and maturation of bone marrow hematopoietic stem cells[1][2][3].
In Vitro
IFN-gamma Protein (Human; 100 ng/mL; 72 h) induces cell death and G2 cell cycle arrest in the ovarian cancer cell line PEO1[4].
IFN-gamma Protein (Human; 0.1-1 nM) induces multinuclear giant cell formation and enhances H2O2 production and lysosomal enzyme activity in human monocyte cultures[5].
IFN-gamma Protein (Human; 1-100 ng/mL; 4-18 h) inhibits IL-10 mRNA and protein expression and dose-dependently upregulates TNF-α transcript and protein levels in LPS-stimulated human monocytes[6].
Verified Bioactivity
The specific activity is >2×107 IU/mg.
Publications (1)
-
Journal Impact Factor
-
Most Recent
-
ACS Nano
2026 Jun 30;20(25):18533-18544. PMID: 42304955
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag Tag Free
-
Accession
P01579 (Q24-Q166)
-
Molecular Construction
-
N-term
-
GMP IFN-gamma (Q24-Q166)
Accession # P01579 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
IFNG; IMD69; Interferon Gamma; IFG; IFN-Gamma; IFI; Immune Interferon
-
AA Sequence
QDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRGRRASQ
-
Predicted Molecular Mass
16.8 kDa
-
Molecular Weight
Approximately 16 kDa & 20 kDa & 25 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 4% Mannitol, 2% Sucrose, 0.02% Tween80, pH 7.4.
<0.01 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in injection water.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (264 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
References
[1]. Kursunel MA, et al. The untold story of IFN-γ in cancer biology. Cytokine Growth Factor Rev. 2016 Oct;31:73-81. [Content Brief]
[2]. Chesler DA, et al. The role of IFN-gamma in immune responses to viral infections of the central nervous system. Cytokine Growth Factor Rev. 2002 Dec;13(6):441-54. [Content Brief]
[3]. Goedhart M, et al. Interferon-Gamma Impairs Maintenance and Alters Hematopoietic Support of Bone Marrow Mesenchymal Stromal Cells. Stem Cells Dev. 2018 May 1;27(9):579-589. [Content Brief]
[4]. Razaghi A, et al. Improved therapeutic efficacy of mammalian expressed-recombinant interferon gamma against ovarian cancer cells. Exp Cell Res. 2017 Oct 1;359(1):20-29. [Content Brief]
[5]. Weinberg JB, et al. Recombinant human gamma-interferon induces human monocyte polykaryon formation. Proc Natl Acad Sci U S A. 1984 Jul;81(14):4554-7. [Content Brief]
[6]. Donnelly RP, et al. Inhibition of IL-10 expression by IFN-gamma up-regulates transcription of TNF-alpha in human monocytes. J Immunol. 1995 Aug 1;155(3):1420-7. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
