GZMA/Granzyme A Protein, Mouse (His-B2M)

GZMA/Granzyme A, abundant in cytotoxic T-cells and natural killer cells, crucially induces caspase-independent pyroptosis upon delivery into target cells. With substrate specificity for lysine or arginine residues, GZMA cleaves APEX1 and nucleosome assembly protein SET, disrupting their activities. This multifunctional protein plays a significant role in diverse cellular processes during immune responses. GZMA/Granzyme A Protein, Mouse (His-B2M) is the recombinant mouse-derived GZMA/Granzyme A protein, expressed by E. coli, with N-6*His, N-B2M labeled tag. The total length of GZMA/Granzyme A Protein, Mouse (His-B2M) is 232 a.a., with molecular weight of ~39.6 kDa.

Granzyme A (GZMA) is a highly abundant protease found in the cytosolic granules of cytotoxic T-cells and natural killer cells, playing a crucial role in immune defense mechanisms. When delivered into the target cell through the immunological synapse, GZMA activates caspase-independent pyroptosis. It exhibits a substrate specificity for cleavage after lysine or arginine residues. Notably, GZMA cleaves APEX1 after 'Lys-31,' disrupting its oxidative repair activity. Additionally, it targets the nucleosome assembly protein SET, cleaving it after 'Lys-189.' This cleavage event disrupts SET's nucleosome assembly activity and facilitates the translocation of the SET complex into the nucleus, where it is involved in nicking and degrading DNA. The multifunctional activities of GZMA underscore its significance in orchestrating diverse cellular processes during immune responses.

Measured by its ability to cleave a colorimetric peptide substrate, N-carbobenzyloxy-Gly-Arg-ThioBenzyl ester (Z-GR-SBzl), in the presence of 5,5’Dithio-bis (2-nitrobenzoic acid) (DTNB). The specific activity is 7995.363 pmol/min/µg, as measured under the described conditions.

Mouse

E. coli

N-6*His;N-B2M

P11032 (I29-V260)

14938  [NCBI]

IIGGDTVVPHSRPYMALLKLSSNTICAGALIEKNWVLTAAHCNVGKRSKFILGAHSINKEPEQQILTVKKAFPYPCYDEYTREGDLQLVRLKKKATVNRNVAILHLPKKGDDVKPGTRCRVAGWGRFGNKSAPSETLREVNITVIDRKICNDEKHYNFHPVIGLNMICAGDLRGGKDSCNGDSGSPLLCDGILRGITSFGGEKCGDRRWPGVYTFLSDKHLNWIKKIMKGSV

Approximately 39.6 kDa

Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.