1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. EGF superfamily
  4. HB-EGF
  5. HB-EGF Protein, Human (CHO)

HB-EGF Protein, Human (CHO)

Cat. No.: HY-P7400
Handling Instructions

HB-EGF Protein, Human (CHO) is shown to play a role in wound healing, cardiac hypertrophy, and heart development and function.

For research use only. We do not sell to patients.

Protein Expression Service

Recombinant Proteins-MedChemExpress
Size Price Stock Quantity
10 μg $90 In-stock
Estimated Time of Arrival: December 31
50 μg $190 In-stock
Estimated Time of Arrival: December 31
100 μg   Get quote  
250 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

HB-EGF Protein, Human (CHO) Related Classifications

  • Technical Parameters

  • Properties

  • Documentation

Species

Human

Source

CHO

Accession

Q99075 (D63-L148)

Gene ID

1839

Synonyms
rHuProheparin-binding EGF-like Growth Factor; DTR; DTS; HEGFL
AA Sequence

DLQEADLDLLRVTLSSKPQALATPNKEEHGKRKKKGKGLGKKRDPCLRKYKDFCIHGECKYVKELRAPSCICHPGYHGERCHGLSL

Molecular Weight

12-14 kDa

Biological Activity
The ED50 is <0.5 ng/mL as measured by 3T3 cells.
Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against PBS.

Endotoxin Level

<0.2 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O or PBS.

Storage & Stability

Stored at -20°C. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Background

Heparin-binding epidermal growth factor-like growth factor (HBEGF) is a heparin-binding member of the EGF family. It is a potent mitogen and chemotactic factor for fibroblasts and smooth muscle cells. As with other EGF family members, HB-EGF binds and activates EGF receptors 1 and 4. HB-EGF has been shown to stimulate the growth of a variety of cells in an autocrine or paracrine manner and to be involved in stromal proliferation. HB-EGF is also a potent inducer of tumor growth and angiogenesis[1].

Documentation
References
  • Reconstitution Calculator

  • Dilution Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
HB-EGF Protein, Human (CHO)
Cat. No.:
HY-P7400
Quantity:
MCE Japan Authorized Agent: