Envelope Glycoprotein E1 Protein, HCV (HEK293, His)

Envelope Glycoprotein E1 Protein, one of two subunits of the envelope glycoprotein found in the hepatitis C virus, is a type 1 transmembrane protein.It associates with envelope glycoprotein E2 as a noncovalent heterodimer, which mediates virus attachment to the host cell, virion internalization through clathrin-dependent endocytosis and fusion with host membrane.E1/E2 heterodimer binds host apolipoproteins.And it also binds to CD81 and activates the epithelial growth factor receptor (EGFR) signaling pathway.Envelope Glycoprotein E1 Protein, HCV (HEK293, His) is the recombinant Virus-derived Envelope Glycoprotein E1 protein, expressed by HEK293 , with N-His labeled tag.

Envelope Glycoprotein E1, one of two subunits of the envelope glycoprotein found in the hepatitis C virus, is a type 1 transmembrane protein with a highly glycosylated N-terminal ectodomain and a C-terminal hydrophobic anchor. Envelope Glycoprotein E1 associates with envelope glycoprotein E2 as a noncovalent heterodimer, which mediates virus attachment to the host cell, virion internalization through clathrin-dependent endocytosis and fusion with host membrane. Envelope Glycoprotein E1 helps the virus attach to the membrane of the targeted cell. In other envelope virus Envelope Glycoprotein E1 has a similar role in helping the virus get into the cell. E1/E2 heterodimer is essential for HCV entry. E1/E2 heterodimer binds host apolipoproteins such as APOB and APOE thereby forming a lipo-viro-particle (LVP). Furthermore, association of APOE with LVP allows the initial virus attachment to cell surface receptors such as the heparan sulfate proteoglycans (HSPGs), syndecan-1 (SDC1), syndecan-1 (SDC2), the low-density lipoprotein receptor (LDLR) and scavenger receptor class B type I (SCARB1). And E1/E2 heterodimer binds to CD81 and activates the epithelial growth factor receptor (EGFR) signaling pathway^[1][2][3][4].

Virus

HEK293

N-His

AAC15725 (Y192-I340)

/

Partial

YEVRNVSGIYHVTNDCSNSSIVYEAADVIMHTPGCVPCVREGNSSRCWVALTPTLAARNASVPTTTIRRHVDLLVGTAAFCSAMYVGDLCGSIFLVSQLFTFSPRRHETVQDCNCSIYPGHVSGHRMAWDMMMNWSPTTALVVSQLLRI

Approximately 36.56 kDa, based on SDS-PAGE under reducing conditions.

≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.22 μm filtered solution of PBS, pH7.4, 5% Trehalose, 5% Mannitol, 0.01% Tween-80.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.