Copy Link Print Information

Envelope Glycoprotein E1 Protein, HCV (HEK293, His)

Customer Review

Based on 1 Customer Validation

Envelope Glycoprotein E1 Protein, one of two subunits of the envelope glycoprotein found in the hepatitis C virus, is a type 1 transmembrane protein.It associates with envelope glycoprotein E2 as a noncovalent heterodimer, which mediates virus attachment to the host cell, virion internalization through clathrin-dependent endocytosis and fusion with host membrane.E1/E2 heterodimer binds host apolipoproteins.And it also binds to CD81 and activates the epithelial growth factor receptor (EGFR) signaling pathway.Envelope Glycoprotein E1 Protein, HCV (HEK293, His) is the recombinant Virus-derived Envelope Glycoprotein E1 protein, expressed by HEK293 , with N-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Virus
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Envelope Glycoprotein E1 Protein, HCV (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

Envelope Glycoprotein E1 Protein, one of two subunits of the envelope glycoprotein found in the hepatitis C virus, is a type 1 transmembrane protein.It associates with envelope glycoprotein E2 as a noncovalent heterodimer, which mediates virus attachment to the host cell, virion internalization through clathrin-dependent endocytosis and fusion with host membrane.E1/E2 heterodimer binds host apolipoproteins.And it also binds to CD81 and activates the epithelial growth factor receptor (EGFR) signaling pathway.Envelope Glycoprotein E1 Protein, HCV (HEK293, His) is the recombinant Virus-derived Envelope Glycoprotein E1 protein, expressed by HEK293 , with N-His labeled tag.

Background

Envelope Glycoprotein E1, one of two subunits of the envelope glycoprotein found in the hepatitis C virus, is a type 1 transmembrane protein with a highly glycosylated N-terminal ectodomain and a C-terminal hydrophobic anchor. Envelope Glycoprotein E1 associates with envelope glycoprotein E2 as a noncovalent heterodimer, which mediates virus attachment to the host cell, virion internalization through clathrin-dependent endocytosis and fusion with host membrane. Envelope Glycoprotein E1 helps the virus attach to the membrane of the targeted cell. In other envelope virus Envelope Glycoprotein E1 has a similar role in helping the virus get into the cell. E1/E2 heterodimer is essential for HCV entry. E1/E2 heterodimer binds host apolipoproteins such as APOB and APOE thereby forming a lipo-viro-particle (LVP). Furthermore, association of APOE with LVP allows the initial virus attachment to cell surface receptors such as the heparan sulfate proteoglycans (HSPGs), syndecan-1 (SDC1), syndecan-1 (SDC2), the low-density lipoprotein receptor (LDLR) and scavenger receptor class B type I (SCARB1). And E1/E2 heterodimer binds to CD81 and activates the epithelial growth factor receptor (EGFR) signaling pathway[1][2][3][4].

Technical Parameters

  • Species Virus
  • Source HEK293
  • Tag N-His
  • Accession

    AAC15725 (Y192-I340)

  • Gene ID
    /
  • Molecular Construction
    • N-term
    • His
    • HCV E1 (Y192-I340)
      Accession # AAC15725
    • C-term
  • Protein Length

    Partial

  • Synonyms

    HCV-E1 Protein; Hepatitis C virus Envelope Glycoprotein E1 / HCV-E1 (subtype 1b, strain HC-J4) Protein

  • AA Sequence

    YEVRNVSGIYHVTNDCSNSSIVYEAADVIMHTPGCVPCVREGNSSRCWVALTPTLAARNASVPTTTIRRHVDLLVGTAAFCSAMYVGDLCGSIFLVSQLFTFSPRRHETVQDCNCSIYPGHVSGHRMAWDMMMNWSPTTALVVSQLLRI

  • Predicted Molecular Mass

    18.7 kDa

  • Molecular Weight

    Approximately 36.56 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH7.4, 5% Trehalose, 5% Mannitol, 0.01% Tween-80.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • Envelope Glycoprotein E1 Protein, HCV (HEK293, His) Product Image
    1/16
  • Envelope Glycoprotein E1 Protein, HCV (HEK293, His) Product Image