Histone H4 Protein, Human/Xenopus laevis
Based on 1 Customer Validation
Histone H4 proteins are core components of nucleosomes, which compact DNA into chromatin and regulate DNA accessibility during cellular processes. Histones, including H4, play critical roles in transcriptional regulation, DNA repair, replication, and chromosome stability. Histone H4 Protein, Human/Xenopus laevis is the recombinant Xenopus laevis-derived Histone H4 protein, expressed by E. coli , with tag free.
- Species: Xenopus laevis; Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
Histone H4 proteins are core components of nucleosomes, which compact DNA into chromatin and regulate DNA accessibility during cellular processes. Histones, including H4, play critical roles in transcriptional regulation, DNA repair, replication, and chromosome stability. Histone H4 Protein, Human/Xenopus laevis is the recombinant Xenopus laevis-derived Histone H4 protein, expressed by E. coli , with tag free.
Background
Histone H4 protein serves as a core component of the nucleosome, a fundamental unit in chromatin architecture responsible for wrapping and compacting DNA, thereby restricting its accessibility to cellular machineries reliant on DNA templates. Histones, including H4, hold a central role in vital cellular processes such as transcription regulation, DNA repair, DNA replication, and maintenance of chromosomal stability. The intricate regulation of DNA accessibility involves a complex array of post-translational modifications, collectively known as the histone code, and dynamic nucleosome remodeling. The nucleosome structure comprises a histone octamer containing two H2A, H2B, H3, and H4 molecules each, organized into one H3-H4 heterotetramer and two H2A-H2B heterodimers. This octamer wraps approximately 147 base pairs of DNA. Additionally, Histone H4 participates in a co-chaperone complex with DNJC9, MCM2, and histone H3.3-H4 dimers, interacting directly with DNJC9 within the complex.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
Technical Parameters
-
Species Xenopus laevis; Human
-
Source E. coli
-
Tag Tag Free
-
Accession
P62805 (S2-G103)
-
Molecular Construction
-
N-term
-
Histone H4 (S2-G103)
Accession # P62805 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
H4C1; H4/B; Prev. HIST1H4A; H4/G; Prev. H4FA; H4FI; Histone H4; H4/I; Histone Cluster 1 H4 Family Member A; H4/A; H4 Histone Family, Member A; H4/J; Histone Cluster 1, H4a; H4FJ; Histone 1, H4a; H4/C; HIST1H4J; H4FC; HIST1H4D; H4/H; HIST1H4C; H4FH; HIST1H
-
AA Sequence
SGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
-
Predicted Molecular Mass
11.4 kDa
-
Molecular Weight
Approximately 11 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
Lyophilized from a 0.2 μm filtered solution of ddH2O, pH 7.0 or PBS, pH 7.4, 8% trehalose.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (235 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
