Histone H4 Protein, Human/Xenopus laevis

Histone H4 proteins are core components of nucleosomes, which compact DNA into chromatin and regulate DNA accessibility during cellular processes. Histones, including H4, play critical roles in transcriptional regulation, DNA repair, replication, and chromosome stability. Histone H4 Protein, Human/Xenopus laevis is the recombinant Xenopus laevis-derived Histone H4 protein, expressed by E. coli , with tag free. The total length of Histone H4 Protein, Human/Xenopus laevis is 102 a.a., with molecular weight of ~11.2 kDa.

Histone H4 protein serves as a core component of the nucleosome, a fundamental unit in chromatin architecture responsible for wrapping and compacting DNA, thereby restricting its accessibility to cellular machineries reliant on DNA templates. Histones, including H4, hold a central role in vital cellular processes such as transcription regulation, DNA repair, DNA replication, and maintenance of chromosomal stability. The intricate regulation of DNA accessibility involves a complex array of post-translational modifications, collectively known as the histone code, and dynamic nucleosome remodeling. The nucleosome structure comprises a histone octamer containing two H2A, H2B, H3, and H4 molecules each, organized into one H3-H4 heterotetramer and two H2A-H2B heterodimers. This octamer wraps approximately 147 base pairs of DNA. Additionally, Histone H4 participates in a co-chaperone complex with DNJC9, MCM2, and histone H3.3-H4 dimers, interacting directly with DNJC9 within the complex.

Xenopus laevis

E. coli

Tag Free

P62805 (S2-G103)

121504  [NCBI]

SGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG

Approximately 11.2 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of ddH₂O, pH 7.0.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US;may vary elsewhere.