HPGDS Protein, Human
HPGDS protein is a multifunctional enzyme with bifunctionality, and its C-terminal and N-terminal domains have different activities.The C terminus acts as an epoxide hydrolase, promoting xenobiotic metabolism by degrading harmful epoxides and regulating physiological mediator levels.HPGDS Protein, Human is the recombinant human-derived HPGDS protein, expressed by E.coli , with tag free.
- Species: Human
- Source: E. coli
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
HPGDS protein is a multifunctional enzyme with bifunctionality, and its C-terminal and N-terminal domains have different activities.The C terminus acts as an epoxide hydrolase, promoting xenobiotic metabolism by degrading harmful epoxides and regulating physiological mediator levels.HPGDS Protein, Human is the recombinant human-derived HPGDS protein, expressed by E.coli , with tag free.
EPHX2, a multifunctional enzyme, exhibits bifunctionality with distinct activities in its C-terminal and N-terminal domains. The C-terminal domain functions as an epoxide hydrolase, targeting both alkene oxides and arene oxides, contributing to xenobiotic metabolism by degrading potentially harmful epoxides. Additionally, it plays a role in modulating the steady-state levels of physiological mediators. On the other hand, the N-terminal domain showcases lipid phosphatase activity, with a preference for substrates like threo-9,10-phosphonooxy-hydroxy-octadecanoic acid and erythro-9,10-phosphonooxy-hydroxy-octadecanoic acid. It also demonstrates phosphatase activity towards lyso-glycerophospholipids, with varying activity towards lysolipids of sphingolipid and isoprenoid phosphates. The versatile functions of EPHX2 contribute to its involvement in diverse biological processes, reflecting its significance in cellular homeostasis.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag Tag Free
-
Accession
O60760 (M1-L199)
-
Molecular Construction
-
N-term
-
HPGDS (M1-L199)
Accession # O60760 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
Glutathione-Dependent PGD Synthase; Glutathione-Requiring Prostaglandin D Synthase; Prostaglandin-H2 D-Isomerase; HPGDS; GSTS; PGDS; PTGDS2
-
AA Sequence
MPNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVDGLTLHQSLAIARYLTKNTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELLTYNAPHLMQDLDTYLGGREWLIGNSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKKVQAIPAVANWIKRRPQTKL
-
Predicted Molecular Mass
22.3 kDa
-
Molecular Weight
Approximately 26 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Documentation
-
Data Sheet (235 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
