TFAM Protein, Human (His)
Based on 2 publication(s) in Google Scholar
TFAM protein regulates lymphangiogenesis, interacts with TEK/TIE2 and ITGA5, and binds to the mitochondrial light chain promoter. It is part of the mitochondrial transcription initiation complex formed with TFB2M and POLRMT and is critical for accurate promoter recognition and transcription initiation. TFAM Protein, Human (His) is the recombinant human-derived TFAM protein, expressed by E. coli, with labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
TFAM protein regulates lymphangiogenesis, interacts with TEK/TIE2 and ITGA5, and binds to the mitochondrial light chain promoter. It is part of the mitochondrial transcription initiation complex formed with TFB2M and POLRMT and is critical for accurate promoter recognition and transcription initiation. TFAM Protein, Human (His) is the recombinant human-derived TFAM protein, expressed by E. coli, with labeled tag.
Background
TFAM protein is involved in the regulation of lymphangiogenesis and interacts with TEK/TIE2 and ITGA5. It binds to the mitochondrial light strand promoter and plays a role in mitochondrial transcription regulation. TFAM is a component of the mitochondrial transcription initiation complex, along with TFB2M and POLRMT, and is required for basal transcription of mitochondrial DNA. TFAM recruits POLRMT to specific promoters and induces structural changes in POLRMT for promoter opening and DNA non-template strand trapping. It is necessary for accurate promoter recognition by the mitochondrial RNA polymerase and promotes transcription initiation. TFAM can unwind DNA and bends the mitochondrial light strand promoter DNA into a U-turn shape through its HMG boxes. It is essential for maintaining normal levels of mitochondrial DNA and may also play a role in organizing and compacting mitochondrial DNA. TFAM can bind DNA as a monomer and can form homodimers. It forms a complex with FOXO3, SIRT3, and POLRMT under metabolic stress and interacts with TFB1M, TFB2M, and CLPX, enhancing DNA-binding.
Publications (2)
-
Journal Impact Factor
-
Most Recent
-
J Ethnopharmacol
Ginseng stem and leaf saponins attenuates pulmonary fibrosis by regulating TFAM-mtDNA homeostasis and suppressing ZBP1-mediated PANoptosis. [Abstract]2026 Jun 28:365:121597. PMID: 41911987 -
Cell Signal
Inhibition of DJ-1 induces TFAM secretion from cancer cells to suppress tumor growth via promoting M1 macrophage polarization. [Abstract]2025 Jul:131:111765. PMID: 40147549
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-6*His
-
Accession
Q00059 (S43-C246)
-
Gene ID7019
-
Protein Length
Full Length of Mature Protein
-
Synonyms
TFAM; Alternative Protein TFAM; Prev. TCF6L2; MTDPS15; Prev. TCF6; TCF6L1; Mitochondrial Transcription Factor 1; TCF6L3; Transcription Factor 6; MTTF1; Transcription Factor 6-Like 2 (Mitochondrial Transcription Factor); MTTFA; Mitochondrial Transcription Factor A; TCF-6; Transcription Factor 6-Like 1; MtTF1; Transcription Factor 6-Like 3; MtTFA; Transcription Factor 6-Like 2; Transcription Factor A, Mitochondrial; TFAM Protein
-
AA Sequence
SSVLASCPKKPVSSYLRFSKEQLPIFKAQNPDAKTTELIRRIAQRWRELPDSKKKIYQDAYRAEWQVYKEEISRFKEQLTPSQIMSLEKEIMDKHLKRKAMTKKKELTLLGKPKRPRSAYNVYVAERFQEAKGDSPQEKLKTVKENWKNLSDSEKELYIQHAKEDETRYHNEMKSWEEQMIEVGRKDLLRRTIKKQRKYGAEEC
-
Predicted Molecular Mass
28.5 kDa
-
Molecular Weight
Approximately 30 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 100 mM Tris-HCl, 10 mM Sodium citrate, 2 M NaCl, 6% trehalose, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
