TFAM Protein, Human (His)

TFAM protein regulates lymphangiogenesis, interacts with TEK/TIE2 and ITGA5, and binds to the mitochondrial light chain promoter. It is part of the mitochondrial transcription initiation complex formed with TFB2M and POLRMT and is critical for accurate promoter recognition and transcription initiation. TFAM Protein, Human (His) is the recombinant human-derived TFAM protein, expressed by E. coli , with labeled tag.

TFAM protein is involved in the regulation of lymphangiogenesis and interacts with TEK/TIE2 and ITGA5. It binds to the mitochondrial light strand promoter and plays a role in mitochondrial transcription regulation. TFAM is a component of the mitochondrial transcription initiation complex, along with TFB2M and POLRMT, and is required for basal transcription of mitochondrial DNA. TFAM recruits POLRMT to specific promoters and induces structural changes in POLRMT for promoter opening and DNA non-template strand trapping. It is necessary for accurate promoter recognition by the mitochondrial RNA polymerase and promotes transcription initiation. TFAM can unwind DNA and bends the mitochondrial light strand promoter DNA into a U-turn shape through its HMG boxes. It is essential for maintaining normal levels of mitochondrial DNA and may also play a role in organizing and compacting mitochondrial DNA. TFAM can bind DNA as a monomer and can form homodimers. It forms a complex with FOXO3, SIRT3, and POLRMT under metabolic stress and interacts with TFB1M, TFB2M, and CLPX, enhancing DNA-binding.

Human

E. coli

N-6*His

Q00059 (S43-C246)

7019

Full Length of Mature Protein

SSVLASCPKKPVSSYLRFSKEQLPIFKAQNPDAKTTELIRRIAQRWRELPDSKKKIYQDAYRAEWQVYKEEISRFKEQLTPSQIMSLEKEIMDKHLKRKAMTKKKELTLLGKPKRPRSAYNVYVAERFQEAKGDSPQEKLKTVKENWKNLSDSEKELYIQHAKEDETRYHNEMKSWEEQMIEVGRKDLLRRTIKKQRKYGAEEC

Approximately 30 kDa, based on SDS-PAGE under reducing conditions.

≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of 100 mM Tris-HCl, 10 mM Sodium citrate, 2 M NaCl, 6% trehalose, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.