IFN-alpha 14/IFNA14 Protein, Mouse (HEK293, His)
Based on 1 publication(s) in Google Scholar
IFN-alpha 14 (IFNA14), belongs to type I interferon family, is produced by macrophages with antiviral activities. IFN-alpha 14/IFNA14 Protein, Mouse (HEK293, His) contains 166 a.a. (C24-K189), produced in HEK293 cells with a C-terminal His-tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- References
- Help & FAQs
Biological Activity
Description
IFN-alpha 14 (IFNA14), belongs to type I interferon family, is produced by macrophages with antiviral activities[1]. IFN-alpha 14/IFNA14 Protein, Mouse (HEK293, His) contains 166 a.a. (C24-K189), produced in HEK293 cells with a C-terminal His-tag.
Background
IFN-alpha 14 (IFNA14; IFN-α14), belongs to the alpha/beta interferon (IFN) family, is produced by the macrophages with antiviral activities[1]. Interferon (IFN) is originally identified as a substance ‘interfering’ with viral replication in vitro. IFN-α/β and related molecules are classified as type I IFNs, as for the other two types of type II IFN (IFN-γ) and type III IFNs (IFN-λ), respectively[2].
Interferon stimulates the production of two enzymes: a protein kinase and an oligoadenylate synthetase. Interferon alpha (IFNa) shows significant biological activity in various cancers, paticularly haematological malignancies such as hairy cell leukaemia and chronic myelogenous leukaemia[3].
IFN-alpha 14 involves in JAK/STAT signaling pathway, is identified as potent regulators that reduces both CTLA4 and FOXP3. Therefore, regulatory T cells (Tregs) as the key cells regulating peripheral autoreactive T lymphocytes, IFNα-14 regulates Treg functional states and destabilises Treg[4].
IFN-alpha14 is a new gene found in tissues of uninfected mice, also found to lack N-glycosylation and have its expression induced in response to viral infection in contrast to IFN-alpha 13[5].
Verified Bioactivity
Measured in antiviral assay using L929 cells infected with vesicular stomatitisvirus (VSV) and the ED50 is typically 5-40 pg/mL.
Publications (1)
-
Journal Impact Factor
-
Most Recent
-
Immunity
An SPP1-SOCS1 pathway constrains interferon responses in tumor-associated macrophages and shapes an immunosuppressive tumor microenvironment. [Abstract]2026 Apr 27:S1074-7613(26)00141-X. PMID: 42049035
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-10*His
-
Accession
Q810G3 (C24-K189)
-
Molecular Construction
-
N-term
-
IFNA14 (C24-K189)
Accession # Q810G3 -
10*His
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
IFNA14; Interferon Alpha-14; Interferon Alpha 14; Interferon Alpha-H; IFN-AlphaH; IFN-Alpha-14; LEIF2H; LeIF H; Interferon Lambda-2-H; Interferon, Alpha 14
-
AA Sequence
CDLPQTHNLRNKRALTLLVKMRRLSPLSCLKDRKDFGFPQEKVDAQQIKKAQAIPVLSELTQQILTLFTSKDSSAAWDATLLDSFCNDLNTQLNDLQGCLMQQVEIQAPPLTQEDSLLAVRKYFHRITVYLREKKHSPCAWEVVRAEIWRALSSSAKLLTSLKEEK
-
Predicted Molecular Mass
20.5 kDa
-
Molecular Weight
Approximately 20 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution
Supplied as a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (265 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
References
[1]. Kumagai Y, et al. Alveolar macrophages are the primary interferon-alpha producer in pulmonary infection with RNA viruses. Immunity. 2007 Aug;27(2):240-52. [Content Brief]
[2]. Zhang SY, et al. Inborn errors of interferon (IFN)-mediated immunity in humans: insights into the respective roles of IFN-alpha/beta, IFN-gamma, and IFN-lambda in host defense. Immunol Rev. 2008 Dec;226:29-40. [Content Brief]
[3]. Raj NB, et al. Identification of a novel virus-responsive sequence in the promoter of murine interferon-alpha genes. J Biol Chem. 1991 Jun 15;266(17):11360-5. [Content Brief]
[4]. Ding M, et al. Secretome screening reveals immunomodulating functions of IFNα-7, PAP and GDF-7 on regulatory T-cells. Sci Rep. 2021 Aug 18;11(1):16767. [Content Brief]
[5]. van Pesch V, et al. Characterization of interferon-alpha 13, a novel constitutive murine interferon-alpha subtype. J Biol Chem. 2003 Nov 21;278(47):46321-8. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
