IFN-gamma R2 Protein, Mouse (HEK293, His)

Measured by its binding ability in a functional ELISA. Immobilized Mouse IFN-gamma R1 at 2 μg/mL can bind Biotinylated Recombinant Mouse IFN-gamma R2 in the presence of Recombinant Mouse IFN-gamma (HY-P7071). The ED₅₀ for this effect is 0.7225 μg/mL.

• 
  Measured by its binding ability in a functional ELISA. Immobilized Mouse IFN-gamma R1 at 2 μg/mL can bind Biotinylated Recombinant Mouse IFN-gamma R2 in the presence of Recombinant Mouse IFN-gamma (HY-P7071). The ED₅₀ for this effect is 0.7225 μg/mL.

Mouse

HEK293

C-10*His

Q63953/NP_032364 (A20-V243)

15980

Partial

ASSPDSFSQLAAPLNPRLHLYNDEQILTWEPSPSSNDPRPVVYQVEYSFIDGSWHRLLEPNCTDITETKCDLTGGGRLKLFPHPFTVFLRVRAKRGNLTSKWVGLEPFQHYENVTVGPPKNISVTPGKGSLVIHFSPPFDVFHGATFQYLVHYWEKSETQQEQVEGPFKSNSIVLGNLKPYRVYCLQTEAQLILKNKKIRPHGLLSNVSCHETTANASARLQQV

Approximately 35-48 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.