IKKβ Protein, Human (sf9, GST)

1 Cited Publications
Customer Review

Based on 1 publication(s) in Google Scholar

IKKβ protein is a serine kinase that is critical in the NF-kappa-B signaling pathway and can respond to various stimuli such as cytokines or cellular stress. As part of the classical IKK complex, IKKβ activates NF-kappa-B through phosphorylation inhibitors, leading to its degradation and release of NF-kappa-B for gene transcription. IKKβ Protein, Human (sf9, GST) is the recombinant human-derived IKKβ protein, expressed by sf9 insect cells , with N-GST labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: Sf9 insect cells
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

IKKβ protein is a serine kinase that is critical in the NF-kappa-B signaling pathway and can respond to various stimuli such as cytokines or cellular stress. As part of the classical IKK complex, IKKβ activates NF-kappa-B through phosphorylation inhibitors, leading to its degradation and release of NF-kappa-B for gene transcription. IKKβ Protein, Human (sf9, GST) is the recombinant human-derived IKKβ protein, expressed by sf9 insect cells , with N-GST labeled tag.

Background

IKKβ protein, a serine kinase, plays a pivotal role in the NF-kappa-B signaling pathway, activated by diverse stimuli such as inflammatory cytokines, bacterial or viral products, DNA damage, or cellular stresses. As a constituent of the canonical IKK complex, IKKβ contributes to the conventional NF-kappa-B activation pathway. It phosphorylates inhibitors of NF-kappa-B on critical serine residues, facilitating their polyubiquitination and subsequent degradation by the proteasome. This orchestrated modification unleashes free NF-kappa-B, allowing its translocation into the nucleus and activation of the transcription of numerous genes involved in immune response, growth control, or protection against apoptosis. Beyond NF-kappa-B inhibitors, IKKβ phosphorylates various signaling pathway components, including NEMO/IKBKG, NF-kappa-B subunits RELA and NFKB1, as well as IKK-related kinases TBK1 and IKBKE. These phosphorylations exert a negative regulation on canonical IKKs and may prevent the excessive production of inflammatory mediators. Moreover, IKKβ targets substrates such as FOXO3, NAA10, NCOA3, BCL10, IRS1, RIPK1, and IRF5, influencing diverse cellular processes and responses.

Verified Bioactivity

This product does not contain protein kinase domain.

Technical Parameters

  • Species Human
  • Source Sf9 insect cells
  • Tag N-GST
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • GST
    • IKKβ (S695-S756)
      Accession # O14920
    • C-term
  • Protein Length

    Partial

  • Synonyms

    IKBKB; IKK-2; Inhibitor Of Nuclear Factor Kappa B Kinase Subunit Beta; CDNA FLJ33978 Fis, Clone DFNES2004354, Highly Similar To Inhibitor Of Nuclear Factor Kappa B Kinase Subunit Beta; IKK-Beta; Inhibitor Of Kappa Light Polypeptide Gene Enhancer In B-Cell

  • AA Sequence

    SNSLPEPAKKSEELVAEAHNLCTLLENAIQDTVREQDQSFTALDWSWLQTEEEEHSCLEQAS

  • Predicted Molecular Mass

    33.7 kDa

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution.

Formulation

Supplied as a 0.22 μm filtered solution of 50 mM Tris-HCl, 500 mM NaCl, 5% glycerol, 5 mM DTT, 0.1 M trehalose, pH 7.5.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

Please use rapid thawing with running water to thaw the protein.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00