1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Transferases (EC 2)
  4. IKKβ Protein, Human (sf9, GST)

IKKβ protein is a serine kinase that is critical in the NF-kappa-B signaling pathway and can respond to various stimuli such as cytokines or cellular stress. As part of the classical IKK complex, IKKβ activates NF-kappa-B through phosphorylation inhibitors, leading to its degradation and release of NF-kappa-B for gene transcription. IKKβ Protein, Human (sf9, GST) is the recombinant human-derived IKKβ protein, expressed by sf9 insect cells , with N-GST labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

1 Publications Citing Use of MCE IKKβ Protein, Human (sf9, GST)

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

IKKβ protein is a serine kinase that is critical in the NF-kappa-B signaling pathway and can respond to various stimuli such as cytokines or cellular stress. As part of the classical IKK complex, IKKβ activates NF-kappa-B through phosphorylation inhibitors, leading to its degradation and release of NF-kappa-B for gene transcription. IKKβ Protein, Human (sf9, GST) is the recombinant human-derived IKKβ protein, expressed by sf9 insect cells , with N-GST labeled tag.

Background

IKKβ protein, a serine kinase, plays a pivotal role in the NF-kappa-B signaling pathway, activated by diverse stimuli such as inflammatory cytokines, bacterial or viral products, DNA damage, or cellular stresses. As a constituent of the canonical IKK complex, IKKβ contributes to the conventional NF-kappa-B activation pathway. It phosphorylates inhibitors of NF-kappa-B on critical serine residues, facilitating their polyubiquitination and subsequent degradation by the proteasome. This orchestrated modification unleashes free NF-kappa-B, allowing its translocation into the nucleus and activation of the transcription of numerous genes involved in immune response, growth control, or protection against apoptosis. Beyond NF-kappa-B inhibitors, IKKβ phosphorylates various signaling pathway components, including NEMO/IKBKG, NF-kappa-B subunits RELA and NFKB1, as well as IKK-related kinases TBK1 and IKBKE. These phosphorylations exert a negative regulation on canonical IKKs and may prevent the excessive production of inflammatory mediators. Moreover, IKKβ targets substrates such as FOXO3, NAA10, NCOA3, BCL10, IRS1, RIPK1, and IRF5, influencing diverse cellular processes and responses.

Biological Activity

This product does not contain protein kinase domain.

Species

Human

Source

Sf9 insect cells

Tag

N-GST

Accession

O14920 (S695-S756)

Gene ID

3551

Molecular Construction
N-term
GST
IKKβ (S695-S756)
Accession # O14920
C-term
Protein Length

Partial

Synonyms
IKBKβ; Inhibitor of nuclear factor kappa-B kinase subunit beta; I-kappa-B-kinase beta; IKK-B; IKK-beta; IkBKB; I-kappa-B kinase 2; IKK2; Nuclear factor NF-kappa-B inhibitor kinase beta; NFKBIKB; Serine/threonine protein kinase IKBKB
AA Sequence

SNSLPEPAKKSEELVAEAHNLCTLLENAIQDTVREQDQSFTALDWSWLQTEEEEHSCLEQAS

Molecular Weight

33.7 kDa

Purity

≥ 90%, as determined by reducing SDS-PAGE.

Appearance

Solution.

Formulation

Supplied as a 0.22 μm filtered solution of 50 mM Tris-HCl, 500 mM NaCl, 5% glycerol, 5 mM DTT, 0.1 M trehalose, pH 7.5.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

Please use rapid thawing with running water to thaw the protein.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

IKKβ Protein, Human (sf9, GST) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

IKKβ Protein, Human (sf9, GST)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IKKβ Protein, Human (sf9, GST)
Cat. No.:
HY-P701786
Quantity:
MCE Japan Authorized Agent: