IKKβ Protein, Human (sf9, GST)
Based on 1 publication(s) in Google Scholar
IKKβ protein is a serine kinase that is critical in the NF-kappa-B signaling pathway and can respond to various stimuli such as cytokines or cellular stress. As part of the classical IKK complex, IKKβ activates NF-kappa-B through phosphorylation inhibitors, leading to its degradation and release of NF-kappa-B for gene transcription. IKKβ Protein, Human (sf9, GST) is the recombinant human-derived IKKβ protein, expressed by sf9 insect cells , with N-GST labeled tag.
- Species: Human
- Source: Sf9 insect cells
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
IKKβ protein is a serine kinase that is critical in the NF-kappa-B signaling pathway and can respond to various stimuli such as cytokines or cellular stress. As part of the classical IKK complex, IKKβ activates NF-kappa-B through phosphorylation inhibitors, leading to its degradation and release of NF-kappa-B for gene transcription. IKKβ Protein, Human (sf9, GST) is the recombinant human-derived IKKβ protein, expressed by sf9 insect cells , with N-GST labeled tag.
Background
IKKβ protein, a serine kinase, plays a pivotal role in the NF-kappa-B signaling pathway, activated by diverse stimuli such as inflammatory cytokines, bacterial or viral products, DNA damage, or cellular stresses. As a constituent of the canonical IKK complex, IKKβ contributes to the conventional NF-kappa-B activation pathway. It phosphorylates inhibitors of NF-kappa-B on critical serine residues, facilitating their polyubiquitination and subsequent degradation by the proteasome. This orchestrated modification unleashes free NF-kappa-B, allowing its translocation into the nucleus and activation of the transcription of numerous genes involved in immune response, growth control, or protection against apoptosis. Beyond NF-kappa-B inhibitors, IKKβ phosphorylates various signaling pathway components, including NEMO/IKBKG, NF-kappa-B subunits RELA and NFKB1, as well as IKK-related kinases TBK1 and IKBKE. These phosphorylations exert a negative regulation on canonical IKKs and may prevent the excessive production of inflammatory mediators. Moreover, IKKβ targets substrates such as FOXO3, NAA10, NCOA3, BCL10, IRS1, RIPK1, and IRF5, influencing diverse cellular processes and responses.
Verified Bioactivity
This product does not contain protein kinase domain.
Publications (1)
-
Journal Impact Factor
-
Most Recent
-
Phytomedicine
Angelicin alleviates sepsis-associated encephalopathy via inhibition of IKK2 and the NF-κB pathway. [Abstract]2025 Nov 25:148:157383. PMID: 41109045
Technical Parameters
-
Species Human
-
Source Sf9 insect cells
-
Tag N-GST
-
Accession
O14920 (S695-S756)
-
Gene ID3551
-
Molecular Construction
-
N-term
-
GST
-
IKKβ (S695-S756)
Accession # O14920 -
C-term
-
-
Protein Length
Partial
-
Synonyms
IKBKB; IKK-2; Inhibitor Of Nuclear Factor Kappa B Kinase Subunit Beta; CDNA FLJ33978 Fis, Clone DFNES2004354, Highly Similar To Inhibitor Of Nuclear Factor Kappa B Kinase Subunit Beta; IKK-Beta; Inhibitor Of Kappa Light Polypeptide Gene Enhancer In B-Cell
-
AA Sequence
SNSLPEPAKKSEELVAEAHNLCTLLENAIQDTVREQDQSFTALDWSWLQTEEEEHSCLEQAS
-
Predicted Molecular Mass
33.7 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
Supplied as a 0.22 μm filtered solution of 50 mM Tris-HCl, 500 mM NaCl, 5% glycerol, 5 mM DTT, 0.1 M trehalose, pH 7.5.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (236 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)