IL-1 alpha Protein, Human (HEK293, His)

IL-1 alpha protein is located in cells and is a key cytokine connecting innate immunity and adaptive immunity. After binding to IL1R1 through IL1RAP, it forms a high-affinity receptor complex, initiates a signaling cascade with adapter molecules such as MYD88, IRAK1 or IRAK4, and activates the NF-kappa-B and MAPK pathways. IL-1 alpha Protein, Human (HEK293, His) is the recombinant human-derived IL-1 alpha protein, expressed by HEK293, with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

IL-1 alpha protein is located in cells and is a key cytokine connecting innate immunity and adaptive immunity. After binding to IL1R1 through IL1RAP, it forms a high-affinity receptor complex, initiates a signaling cascade with adapter molecules such as MYD88, IRAK1 or IRAK4, and activates the NF-kappa-B and MAPK pathways. IL-1 alpha Protein, Human (HEK293, His) is the recombinant human-derived IL-1 alpha protein, expressed by HEK293, with C-His labeled tag.

Background

Interleukin-1 alpha (IL-1 alpha), a cytokine consistently found intracellularly in nearly all quiescent non-hematopoietic cells, plays a pivotal role in inflammation and serves as a crucial link between the innate and adaptive immune systems. Upon binding to its receptor IL1R1, in conjunction with its accessory protein IL1RAP, IL-1 alpha forms the high-affinity interleukin-1 receptor complex. This complex initiates signaling cascades involving the recruitment of adapter molecules such as MYD88, IRAK1, or IRAK4, subsequently leading to the activation of NF-kappa-B and the three MAPK pathways—p38, p42/p44, and JNK pathways. Intracellularly, IL-1 alpha acts as an alarmin, and its release into the extracellular space upon cell death, following cell membrane disruption, induces inflammation and signals the host response to injury or damage. Beyond its role as a danger signal released during cell necrosis, IL-1 alpha also directly senses DNA damage, serving as a signal for genotoxic stress without compromising cell integrity. Moreover, IL-1 alpha's interactions with proteins such as TMED10, IL1R1, and S100A13 contribute to its regulatory mechanisms, mediating translocation, secretion, and export processes.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • IL-1α (S113-A271)
      Accession # P01583
    • His
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    IL1A; IL-1A; Prev. IL1; Preinterleukin 1 Alpha; IL1F1; Interleukin-1 Alpha; Hematopoietin-1; IL-1 Alpha; IL1-ALPHA; Interleukin 1 Alpha; Pro-Interleukin-1-Alpha

  • AA Sequence

    SAPFSFLSNVKYNFMRIIKYEFILNDALNQSIIRANDQYLTAAALHNLDEAVKFDMGAYKSSKDDAKITVILRISKTQLYVTAQDEDQPVLLKEMPEIPKTITGSETNLLFFWETHGTKNYFTSVAHPNLFIATKQDYWVCLAGGPPSITDFQILENQA

  • Predicted Molecular Mass

    19.9 kDa

  • Molecular Weight

    Approximately 25-27 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00