IL-17C Protein, Human (Biotinylated, HEK293, His-Avi)
IL-17C is an early response cytokine in the defense against bacterial pathogens and upregulates the expression of a variety of antimicrobial peptides. IL-17C stimulates the release of cytokines and is implicated in autoimmune disorders and bacterial infections. IL-17C Protein, Human (Biotinylated, HEK293, His-Avi) is a biotinylated recombinant human IL-17C protein with His tag and Avi tag at the C-terminus and is expressed in HEK293 cells.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
IL-17C is an early response cytokine in the defense against bacterial pathogens and upregulates the expression of a variety of antimicrobial peptides. IL-17C stimulates the release of cytokines and is implicated in autoimmune disorders and bacterial infections[1]. IL-17C Protein, Human (Biotinylated, HEK293, His-Avi) is a biotinylated recombinant human IL-17C protein with His tag and Avi tag at the C-terminus and is expressed in HEK293 cells.
Background
Interleukin-17C (IL-17C) belongs to the IL-17 cytokine family. IL-17C is predominantly expressed by epithelial cells.
Human and mouse IL-17C shares 76.68% sequence identity.
IL-17C binds to its functional receptor, a heterodimer formed by IL-17RA and IL-17RE. TLR2, TLR3 and TLR5 upregulate the expression of IL-17C at mucosal surfaces. The expression of IL-17C is also regulated by cytokines (TNF-α, IL-1β and IL-17A). IL-17C is an early response cytokine in the defense against bacterial pathogens and upregulates the expression of a variety of antimicrobial peptides including human beta-defensin 2 (hBD2), Lipocalin 2 (LCN2), and granzyme B. IL-17C also stimulates the release of cytokines (IL-1β, TNF-α, and IL-6).
IL-17C is implicated in autoimmune disorders and bacterial infections[1].
In Vitro
IL-17C is abundantly expressed in inflamed skin[2].
IL-17C (100 ng/mL; 16 h) potentiates TNF-α effects and mediates immune cell recruitment by induction of chemokines in keratinocytes[2].
IL-17C (200 ng/mL; 24 h) and TNF-α (2 ng/mL) induce characteristic psoriasis-related transcriptome genes in both additive and synergistic manners. IL-17C (6 h) increases mRNA expression of TNF-α and IL-6[3].
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-Avi;C-6*His
-
Accession
Q9P0M4 (H19-V197)
-
Molecular Construction
-
N-term
-
IL-17C (H19-V197)
Accession # Q9P0M4 -
6*His-Avi
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Conjugation
Biotin
-
Conjugate Method
The single lysine residue in Avitag is biotinylated through an enzymatic reaction.
-
Synonyms
IL17C; Cytokine CX2; Interleukin 17C; MGC126884; IL-17C; MGC138401; CX2; IL-21; Interleukin-17C
-
AA Sequence
HHDPSLRGHPHSHGTPHCYSAEELPLGQAPPHLLARGAKWGQALPVALVSSLEAASHRGRHERPSATTQCPVLRPEEVLEADTHQRSISPWRYRVDTDEDRYPQKLAFAECLCRGCIDARTGRETAALNSVRLLQSLLVLRRRPCSRDGSGLPTPGAFAFHTEFIHVPVGCTCVLPRSV
-
Predicted Molecular Mass
22.4 kDa
-
Molecular Weight
Approximately 24-28 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in 4 mM HCl. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
References
[1]. Swedik S, et al. IL-17C in human mucosal immunity: More than just a middle child. Cytokine. 2021 Oct;146:155641. [Content Brief]
[2]. Lauffer F, et al. IL-17C amplifies epithelial inflammation in human psoriasis and atopic eczema. J Eur Acad Dermatol Venereol. 2020 Apr;34(4):800-809. [Content Brief]
[3]. Johnston A, et al. Keratinocyte overexpression of IL-17C promotes psoriasiform skin inflammation. J Immunol. 2013 Mar 1;190(5):2252-62. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)