IL-17RB Protein, Mouse (HEK293, His)
IL-17RB (Interleukin 17 receptor B), a protein encoded by the IL17RB gene, is a receptor for the pro-inflammatory cytokines IL17B and IL17E. IL-17RB expression is high in kidney, pancreas, liver, brain, and intestines. IL-17RB may play a role in hematopoietic cell differentiation and growth. IL-17RB is involved in inflammatory diseases and cancers. IL-17RB Protein, Mouse (HEK293, His) is produced in HEK293 cells with six C-Terminal His-tags. It consists of 269 amino acids (R18-G286).
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- References
- Help & FAQs
Biological Activity
Description
IL-17RB (Interleukin 17 receptor B), a protein encoded by the IL17RB gene, is a receptor for the pro-inflammatory cytokines IL17B and IL17E. IL-17RB expression is high in kidney, pancreas, liver, brain, and intestines. IL-17RB may play a role in hematopoietic cell differentiation and growth. IL-17RB is involved in inflammatory diseases and cancers[1][2]. IL-17RB Protein, Mouse (HEK293, His) is produced in HEK293 cells with six C-Terminal His-tags. It consists of 269 amino acids (R18-G286).
Background
IL-17RB (Interleukin 17 receptor B), a 47.9 kDa transmembrane protein (462 aa) that belongs to the IL-17 receptor family, and can be activated by IL-17B. It has been proved to be involved in inflammatory diseases and cancers. IL-17RB is expressed in various endocrine tissues and in epithelial cells in different organs such as kidney and liver and mucosal tissues[1][2][3].
The amino acid sequence of human IL-17RB protein has low homology with mouse IL-17B protein.
IL-17RB has a SEFIR cytoplasmic domain implicated in homotypic dimerization and recruitment of signaling proteins (shared with IL-17RA) and a TRAF6-binding domain (not found in IL-17RA). IL-17B shares its receptor IL-17RB with IL-17E (also known as IL-25) that binds to the heterodimeric IL-17RA/IL-17RB complex. The binding affinity (KD) of IL-17B for IL-17RB is around 30-fold lower than that of IL-17E. It does not bind IL-17, IL-17C and IL-17F. Interleukin-17 (IL-17) plays a pivotal role in inflammatory diseases and cancers. IL-17 acts its role through IL-17 receptor (IL-17R). The IL-17R family are single transmembrane proteins that include the subtype receptors of IL-17RA to IL-17RE. Upon ligand binding, IL-17RB activates the canonical NK-κB pathway as well as ERK, JNK, and p38. Moreover, TRAF6 binds to IL-17RB independently of its ligand and participates in IL-17RB-dependent NF-κB activation[1][2][3].
It is reported that IL-17RB expression is significantly increased in gastric cancer tissues. Moreover, overexpression of IL-17RB is strongly associated with metastasis and inversely correlates with progression-free survival in pancreatic cancer. IL-17RB can enhance thyroid cancer cell invasion and metastasis via ERK1/2 pathway-mediated MMP-9 expression[1]. By using a rodent ortholog of IL-17BR as a probe, IL-17BR message was found to be drastically up-regulated during intestinal inflammation elicited by indomethacin treatment in rats[2]. IL-17RB expression in human innate type 2 lymphocytes, natural killer T (NKT) cells, and Th2 cells suggests a potential role in immune cells[3].
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-6*His
-
Accession
Q9JIP3-1 (R18-G286)
-
Protein Length
Extracellular Domain
-
Synonyms
IL17RB; Interleukin-17B Receptor; Prev. IL17BR; IL-17B Receptor; EVI27; IL-17Rh1; CRL4; IL-17RB; IL17RH1; Interleukin 17 Receptor Homolog 1; Interleukin-17 Receptor B; Interleukin 17B Receptor; IL-17 Receptor Homolog 1; Cytokine Receptor CRL4; Cytokine Re
-
AA Sequence
REPTIQCGSETGPSPEWMVQHTLTPGDLRDLQVELVKTSVAAEEFSILMNISWILRADASIRLLKATKICVSGKNNMNSYSCVRCNYTEAFQSQTRPSGGKWTFSYVGFPVELSTLYLISAHNIPNANMNEDSPSLSVNFTSPGCLNHVMKYKKQCTEAGSLWDPDITACKKNEKMVEVNFTTNPLGNRYTILIQRDTTLGFSRVLENKLMRTSVAIPVTEESEGAVVQLTPYLHTCGNDCIRREGTVVLCSETSAPIPPDDNRRMLGG
-
Predicted Molecular Mass
30.6 kDa
-
Molecular Weight
Approximately 38-45 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
References
[1]. Lei Ren, et al. IL-17RB enhances thyroid cancer cell invasion and metastasis via ERK1/2 pathway-mediated MMP-9 expression. Mol Immunol. 2017 Oct;90:126-135. [Content Brief]
[2]. Y Shi, et al. A novel cytokine receptor-ligand pair. Identification, molecular characterization, and in vivo immunomodulatory activity. J Biol Chem. 2000 Jun 23;275(25):19167-76. [Content Brief]
[3]. Jérémy Bastid, et al. The Emerging Role of the IL-17B/IL-17RB Pathway in Cancer. Front Immunol. 2020 Apr 21;11:718. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
