1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Interleukin & Receptors
  4. IL-18BP
  5. IL-18BP Protein, Human (HEK293, His)

IL-18BP isoform A, a potent regulator, binds to IL-18, effectively inhibiting its activity. Serving as a suppressor, IL-18BP restrains early TH1 cytokine responses, playing a pivotal role in modulating immune reactions and maintaining cytokine balance. IL-18BP Protein, Human (HEK293, His) is the recombinant human-derived IL-18BP protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
20 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

IL-18BP isoform A, a potent regulator, binds to IL-18, effectively inhibiting its activity. Serving as a suppressor, IL-18BP restrains early TH1 cytokine responses, playing a pivotal role in modulating immune reactions and maintaining cytokine balance. IL-18BP Protein, Human (HEK293, His) is the recombinant human-derived IL-18BP protein, expressed by HEK293 , with C-His labeled tag.

Background

IL-18 binding protein (IL-18BP), specifically isoform A, serves as a potent regulator by binding to IL-18 and effectively inhibiting its activity. Acting as a suppressor, IL-18BP functions to restrain the early TH1 cytokine response, highlighting its pivotal role in modulating immune reactions and maintaining cytokine balance.

Biological Activity

1.Immobilized Human IL-18, No Tag at 5 μg/mL (100 μL/well) on the plate. Dose response curve for Human IL-18BP, His Tag with the EC50 of 10-15 ng/mL determined by ELISA.
2.Human IL-18BP, His Tag captured on CM5 Chip via Anti-his antibody can bind Human IL-18, No Tag with an affinity constant of 0.3-0.5 nM as determined in SPR assay (Biacore T200).
3.Measured by its ability to inhibit the IL-18-induced response of human natural killer lymphoma NK-92 cells. The ED50 for this effect is 0.04 - 0.08 µg/mL in the presence of 30 ng/mL of recombinant Human IL-18.
4.Loaded Human IL-18BP, His Tag on Anti-HisBiosensor can bind Human IL-18, No Tag with an affinity constant of 1.80 nM as determined in BLI assay.

Species

Human

Source

HEK293

Tag

C-8*His

Accession

O95998-2 (T31-G194)

Gene ID
Molecular Construction
N-term
IL-18BP (T31-G194)
Accession # O95998-2
8*His
C-term
Protein Length

Full Length of Isoform-2 Mature Protein

Synonyms
IL-18BP; Igifbp
AA Sequence

TPVSQTTTAATASVRSTKDPCPSQPPVFPAAKQCPALEVTWPEVEVPLNGTLSLSCVACSRFPNFSILYWLGNGSFIEHLPGRLWEGSTSRERGSTGTQLCKALVLEQLTPALHSTNFSCVLVDPEQVVQRHVVLAQLWAGLRATLPPTQEALPSSHSSPQQQG

Predicted Molecular Mass
18.7 kDa
Molecular Weight

Approximately 40-60 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Glycosylation
Yes
Purity

≥ 95%, as determined by Bis-Tris PAGE.

Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 5% trehalose.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

IL-18BP Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

IL-18BP Protein, Human (HEK293, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IL-18BP Protein, Human (HEK293, His)
Cat. No.:
HY-P77709
Quantity:
MCE Japan Authorized Agent: