IL-18BP Protein, Human (HEK293, His)

Customer Review

Based on 1 Customer Validation

IL-18BP isoform A, a potent regulator, binds to IL-18, effectively inhibiting its activity. Serving as a suppressor, IL-18BP restrains early TH1 cytokine responses, playing a pivotal role in modulating immune reactions and maintaining cytokine balance. IL-18BP Protein, Human (HEK293, His) is the recombinant human-derived IL-18BP protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

IL-18BP isoform A, a potent regulator, binds to IL-18, effectively inhibiting its activity. Serving as a suppressor, IL-18BP restrains early TH1 cytokine responses, playing a pivotal role in modulating immune reactions and maintaining cytokine balance. IL-18BP Protein, Human (HEK293, His) is the recombinant human-derived IL-18BP protein, expressed by HEK293 , with C-His labeled tag.

Background

IL-18 binding protein (IL-18BP), specifically isoform A, serves as a potent regulator by binding to IL-18 and effectively inhibiting its activity. Acting as a suppressor, IL-18BP functions to restrain the early TH1 cytokine response, highlighting its pivotal role in modulating immune reactions and maintaining cytokine balance.

Verified Bioactivity

1.Immobilized Human IL-18, No Tag at 5 μg/mL (100 μL/well) on the plate. Dose response curve for Human IL-18BP, His Tag with the EC50 of 10-15 ng/mL determined by ELISA.
2.Human IL-18BP, His Tag captured on CM5 Chip via Anti-his antibody can bind Human IL-18, No Tag with an affinity constant of 0.3-0.5 nM as determined in SPR assay (Biacore T200).
3.Measured by its ability to inhibit the IL-18-induced response of human natural killer lymphoma NK-92 cells. The ED50 for this effect is 0.04 - 0.08 µg/mL in the presence of 30 ng/mL of recombinant Human IL-18.
4.Loaded Human IL-18BP, His Tag on Anti-HisBiosensor can bind Human IL-18, No Tag with an affinity constant of 1.80 nM as determined in BLI assay.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-8*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • IL-18BP (T31-G194)
      Accession # O95998-2
    • 8*His
    • C-term
  • Protein Length

    Full Length of Isoform-2

  • Synonyms

    IL18BP; MC51L-53L-54L Homolog Gene Product; Interleukin 18 Binding Protein; Tadekinig-Alfa; Interleukin-18-Binding Protein; IL-18BP; IL18BPa; FVH

  • AA Sequence

    TPVSQTTTAATASVRSTKDPCPSQPPVFPAAKQCPALEVTWPEVEVPLNGTLSLSCVACSRFPNFSILYWLGNGSFIEHLPGRLWEGSTSRERGSTGTQLCKALVLEQLTPALHSTNFSCVLVDPEQVVQRHVVLAQLWAGLRATLPPTQEALPSSHSSPQQQG

  • Predicted Molecular Mass

    18.7 kDa

  • Molecular Weight

    Approximately 35-60 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by Bis-Tris PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 5% trehalose.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00