1. Protéines recombinantes
  2. Cytokines and Growth Factors
  3. Interleukin & Receptors
  4. IL-19
  5. IL-19 Protein, Human (sf9, His)

IL-19 protein acts as an anti-inflammatory and pro-angiogenic cytokine. IL-19 Protein, Human (sf9, His) is the recombinant human-derived IL-19 protein, expressed by Sf9 insect cells , with C-His labeled tag.

Nos produits utilisent uniquement pour la recherche. Nous ne vendons pas aux patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Obtenir un devis  
100 μg   Obtenir un devis  

* Veuillez sélectionner la quantité avant d'ajouter des articles.

Top Publications Citing Use of Products
  • Activité biologique

  • Paramètres Techniques

  • Propriétés

  • Description

Description

IL-19 protein acts as an anti-inflammatory and pro-angiogenic cytokine. IL-19 Protein, Human (sf9, His) is the recombinant human-derived IL-19 protein, expressed by Sf9 insect cells , with C-His labeled tag.

Background

The IL-19 Protein serves a dual role as an anti-inflammatory and proangiogenic factor. It plays a crucial role in shaping adaptive immunity towards an anti-inflammatory phenotype by inducing T-helper 2 responses, achieved through the down-regulation of IFN-gamma and the up-regulation of IL4 and IL13. Produced by osteocytes, IL-19 also contributes to granulopoiesis and the formation of neutrophils. Its biological effects are mediated through a receptor complex comprising the IL20RA and IL20RB heterodimer. Upon binding, IL-19 activates the Janus kinase (JAK) and signal transducer and activator of transcription (STAT) pathway, particularly emphasizing STAT3 activation, highlighting its pivotal role in diverse immunomodulatory functions.

Species

Human

Source

Sf9 insect cells

Tag

C-His

Accession

Q9UHD0-1 (L25-A177)

Gene ID
Molecular Construction
N-term
IL-19 (L25-A177)
Accession # Q9UHD0-1
His
C-term
Protein Length

Full Length of Isoform-1 Mature Protein

Synonyms
Interleukin-19; IL-19; IL19; ZMDA1
AA Sequence

LRRCLISTDMHHIEESFQEIKRAIQAKDTFPNVTILSTLETLQIIKPLDVCCVTKNLLAFYVDRVFKDHQEPNPKILRKISSIANSFLYMQKTLRQCQEQRQCHCRQEATNATRVIHDNYDQLEVHAAAIKSLGELDVFLAWINKNHEVMFSA

Predicted Molecular Mass
19.2 kDa
Masse moléculaire

Approximately 20-25 kDa, based on SDS-PAGE under reducing conditions.

Glycosylation
Yes
Pureté

≥ 95%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

IL-19 Protein, Human (sf9, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Vos produits récemment consultés:

Demande en ligne

Your information is safe with us. * Required Fields.

IL-19 Protein, Human (sf9, His)

 

Requested Quantity *

Nom du demandeur *

 

Civilité

Adresse e-mail *

 

Numéro de téléphone *

Department

 

Nom de l'organisation *

City

État

Country or Region *

     

Remarques

Bulk Inquiry

Inquiry Information

Nom du produit:
IL-19 Protein, Human (sf9, His)
Cat. No.:
HY-P73183
Quantité:
MCE Japan Authorized Agent: