IL-19 Protein, Human (sf9, His)

IL-19 protein acts as an anti-inflammatory and pro-angiogenic cytokine. IL-19 Protein, Human (sf9, His) is the recombinant human-derived IL-19 protein, expressed by Sf9 insect cells , with C-His labeled tag.

The IL-19 Protein serves a dual role as an anti-inflammatory and proangiogenic factor. It plays a crucial role in shaping adaptive immunity towards an anti-inflammatory phenotype by inducing T-helper 2 responses, achieved through the down-regulation of IFN-gamma and the up-regulation of IL4 and IL13. Produced by osteocytes, IL-19 also contributes to granulopoiesis and the formation of neutrophils. Its biological effects are mediated through a receptor complex comprising the IL20RA and IL20RB heterodimer. Upon binding, IL-19 activates the Janus kinase (JAK) and signal transducer and activator of transcription (STAT) pathway, particularly emphasizing STAT3 activation, highlighting its pivotal role in diverse immunomodulatory functions.

Human

Sf9 insect cells

C-His

Q9UHD0-1 (L25-A177)

29949  [NCBI]

Full Length of Isoform-1 Mature Protein

LRRCLISTDMHHIEESFQEIKRAIQAKDTFPNVTILSTLETLQIIKPLDVCCVTKNLLAFYVDRVFKDHQEPNPKILRKISSIANSFLYMQKTLRQCQEQRQCHCRQEATNATRVIHDNYDQLEVHAAAIKSLGELDVFLAWINKNHEVMFSA

Approximately 20-25 kDa, based on SDS-PAGE under reducing conditions.

≥ 95%, as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.