IL-21R Protein, Human (HEK293, His)
Based on 1 Customer Validation
IL-21R protein, a receptor for interleukin-21, forms a heterodimer with the common gamma subunit and associates with Janus kinase 1 (JAK1). These interactions are pivotal for transducing the cellular responses initiated by interleukin-21, regulating immune processes and inflammatory pathways. IL-21R Protein, Human (HEK293, His) is the recombinant human-derived IL-21R protein, expressed by HEK293 , with C-6*His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
IL-21R protein, a receptor for interleukin-21, forms a heterodimer with the common gamma subunit and associates with Janus kinase 1 (JAK1). These interactions are pivotal for transducing the cellular responses initiated by interleukin-21, regulating immune processes and inflammatory pathways. IL-21R Protein, Human (HEK293, His) is the recombinant human-derived IL-21R protein, expressed by HEK293 , with C-6*His labeled tag.
Background
The IL-21R protein serves as a receptor for interleukin-21. It forms a heterodimer with the common gamma subunit and associates with Janus kinase 1 (JAK1). Through this interaction, the receptor facilitates the signaling cascade initiated by interleukin-21, a cytokine with diverse immunoregulatory functions. The formation of the IL-21R heterodimer and its association with JAK1 are pivotal steps in transducing the cellular responses triggered by interleukin-21, contributing to the regulation of immune processes and inflammatory pathways.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-6*His
-
Accession
Q9HBE5 (C20-P236)
-
Protein Length
Extracellular Domain
-
Synonyms
IL21R; IL-21 Receptor; Interleukin 21 Receptor; NILR; CD360; CD360 Antigen; Novel Interleukin Receptor; IL-21R; Interleukin-21 Receptor; IMD56
-
AA Sequence
CPDLVCYTDYLQTVICILEMWNLHPSTLTLTWQDQYEELKDEATSCSLHRSAHNATHATYTCHMDVFHFMADDIFSVNITDQSGNYSQECGSFLLAESIKPAPPFNVTVTFSGQYNISWRSDYEDPAFYMLKGKLQYELQYRNRGDPWAVSPRRKLISVDSRSVSLLPLEFRKDSSYELQVRAGPMPGSSYQGTWSEWSDPVIFQTQSEELKEGWNP
-
Predicted Molecular Mass
26 kDa
-
Molecular Weight
Approximately 37-55 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.2 μm filtered solution of 20 mM PB,150 mM NaCl, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
