IL-23 alpha Protein, Mouse (Biotinylated, HEK293, His-Avi)

Customer Review

Based on 1 Customer Validation

IL-23 alpha is a key component that binds to IL12B to produce IL-23 interleukin, a heterodimeric cytokine critical in innate and adaptive immunity. IL-23 functions together with IL-17 in peripheral tissues to respond acutely to infection. IL-23 alpha Protein, Mouse (Biotinylated, HEK293, His-Avi) is the recombinant mouse-derived IL-23 alpha protein, expressed by HEK293 , with C-His, C-Avi labeled tag.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

IL-23 alpha is a key component that binds to IL12B to produce IL-23 interleukin, a heterodimeric cytokine critical in innate and adaptive immunity. IL-23 functions together with IL-17 in peripheral tissues to respond acutely to infection. IL-23 alpha Protein, Mouse (Biotinylated, HEK293, His-Avi) is the recombinant mouse-derived IL-23 alpha protein, expressed by HEK293 , with C-His, C-Avi labeled tag.

Background

IL-23 alpha, as a crucial component, associates with IL12B to form the IL-23 interleukin, a heterodimeric cytokine playing key roles in both innate and adaptive immunity. Operating in peripheral tissues, IL-23, in conjunction with IL-17, constitutes an acute response to infections. It binds to a heterodimeric receptor complex composed of IL12RB1 and IL23R, activating the Jak-Stat signaling cascade, preferentially stimulating memory T-cells, and fostering the production of pro-inflammatory cytokines. This cytokine induces autoimmune inflammation, potentially contributing to autoimmune inflammatory diseases and playing a significant role in tumorigenesis. Released by antigen-presenting cells such as dendritic cells or macrophages, IL-23 binds to its receptor complex, initiating signaling pathways that activate various cellular responses, including the production of interleukin-17A/IL17A and promoting early and effective intracellular bacterial clearance. Additionally, IL-23 supports the expansion and survival of T-helper 17 cells, a CD4-positive helper T-cell subset known for producing IL-17, along with other IL-17-producing cells.

Technical Parameters

  • Species Mouse
  • Source HEK293
  • Tag C-Avi;C-8*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • IL-23α (V22-A196)
      Accession # Q9EQ14
    • 8*His-Avi
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Conjugation

    Biotin

  • Conjugate Method

    The single lysine residue in Avitag is biotinylated through an enzymatic reaction.

  • Synonyms

    IL23A; Interleukin 23, Alpha Subunit P19; Interleukin 23 Subunit Alpha; Interleukin-23 Subunit Alpha; SGRF; Interleukin-23 Subunit P19; IL23P19; IL-23 Subunit Alpha; IL-23A; IL-23p19; IL-23; IL-23-A; P19; JKA3 Induced Upon T-Cell Activation; Interleukin-S

  • AA Sequence

    VPRSSSPDWAQCQQLSRNLCMLAWNAHAPAGHMNLLREEEDEETKNNVPRIQCEDGCDPQGLKDNSQFCLQRIRQGLAFYKHLLDSDIFKGEPALLPDSPMEQLHTSLLGLSQLLQPEDHPRETQQMPSLSSSQQWQRPLLRSKILRSLQAFLAIAARVFAHGAATLTEPLVPTA

  • Predicted Molecular Mass

    23.4 kDa

  • Molecular Weight

    Approximately 25-30 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Purity

    ≥ 95%, as determined by Bis-Tris PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00