IL-23 alpha Protein, Mouse (Biotinylated, HEK293, His-Avi)
Based on 1 Customer Validation
IL-23 alpha is a key component that binds to IL12B to produce IL-23 interleukin, a heterodimeric cytokine critical in innate and adaptive immunity. IL-23 functions together with IL-17 in peripheral tissues to respond acutely to infection. IL-23 alpha Protein, Mouse (Biotinylated, HEK293, His-Avi) is the recombinant mouse-derived IL-23 alpha protein, expressed by HEK293 , with C-His, C-Avi labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
IL-23 alpha is a key component that binds to IL12B to produce IL-23 interleukin, a heterodimeric cytokine critical in innate and adaptive immunity. IL-23 functions together with IL-17 in peripheral tissues to respond acutely to infection. IL-23 alpha Protein, Mouse (Biotinylated, HEK293, His-Avi) is the recombinant mouse-derived IL-23 alpha protein, expressed by HEK293 , with C-His, C-Avi labeled tag.
Background
IL-23 alpha, as a crucial component, associates with IL12B to form the IL-23 interleukin, a heterodimeric cytokine playing key roles in both innate and adaptive immunity. Operating in peripheral tissues, IL-23, in conjunction with IL-17, constitutes an acute response to infections. It binds to a heterodimeric receptor complex composed of IL12RB1 and IL23R, activating the Jak-Stat signaling cascade, preferentially stimulating memory T-cells, and fostering the production of pro-inflammatory cytokines. This cytokine induces autoimmune inflammation, potentially contributing to autoimmune inflammatory diseases and playing a significant role in tumorigenesis. Released by antigen-presenting cells such as dendritic cells or macrophages, IL-23 binds to its receptor complex, initiating signaling pathways that activate various cellular responses, including the production of interleukin-17A/IL17A and promoting early and effective intracellular bacterial clearance. Additionally, IL-23 supports the expansion and survival of T-helper 17 cells, a CD4-positive helper T-cell subset known for producing IL-17, along with other IL-17-producing cells.
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-Avi;C-8*His
-
Accession
Q9EQ14 (V22-A196)
-
Molecular Construction
-
N-term
-
IL-23α (V22-A196)
Accession # Q9EQ14 -
8*His-Avi
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Conjugation
Biotin
-
Conjugate Method
The single lysine residue in Avitag is biotinylated through an enzymatic reaction.
-
Synonyms
IL23A; Interleukin 23, Alpha Subunit P19; Interleukin 23 Subunit Alpha; Interleukin-23 Subunit Alpha; SGRF; Interleukin-23 Subunit P19; IL23P19; IL-23 Subunit Alpha; IL-23A; IL-23p19; IL-23; IL-23-A; P19; JKA3 Induced Upon T-Cell Activation; Interleukin-S
-
AA Sequence
VPRSSSPDWAQCQQLSRNLCMLAWNAHAPAGHMNLLREEEDEETKNNVPRIQCEDGCDPQGLKDNSQFCLQRIRQGLAFYKHLLDSDIFKGEPALLPDSPMEQLHTSLLGLSQLLQPEDHPRETQQMPSLSSSQQWQRPLLRSKILRSLQAFLAIAARVFAHGAATLTEPLVPTA
-
Predicted Molecular Mass
23.4 kDa
-
Molecular Weight
Approximately 25-30 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Purity
≥ 95%, as determined by Bis-Tris PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)