IL-23 alpha Protein, Mouse (Biotinylated, HEK293, His-Avi)

IL-23 alpha, a crucial component, combines with IL12B to create the IL-23 interleukin, a heterodimeric cytokine pivotal in innate and adaptive immunity. Operating in peripheral tissues, IL-23, along with IL-17, responds acutely to infections. It binds to IL12RB1 and IL23R, activating Jak-Stat signaling, preferentially stimulating memory T-cells, and inducing pro-inflammatory cytokines. Released by antigen-presenting cells, IL-23 plays a role in autoimmune inflammation, contributing to autoimmune diseases and tumorigenesis, and supports the expansion of T-helper 17 cells. IL-23 alpha Protein, Mouse (Biotinylated, HEK293, His-Avi) is the recombinant mouse-derived IL-23 alpha protein, expressed by HEK293, with C-His, C-Avi labeled tag. The total length of IL-23 alpha Protein, Mouse (Biotinylated, HEK293, His-Avi) is 175 a.a., with molecular weight of 23-28 kDa.

IL-23 alpha, as a crucial component, associates with IL12B to form the IL-23 interleukin, a heterodimeric cytokine playing key roles in both innate and adaptive immunity. Operating in peripheral tissues, IL-23, in conjunction with IL-17, constitutes an acute response to infections. It binds to a heterodimeric receptor complex composed of IL12RB1 and IL23R, activating the Jak-Stat signaling cascade, preferentially stimulating memory T-cells, and fostering the production of pro-inflammatory cytokines. This cytokine induces autoimmune inflammation, potentially contributing to autoimmune inflammatory diseases and playing a significant role in tumorigenesis. Released by antigen-presenting cells such as dendritic cells or macrophages, IL-23 binds to its receptor complex, initiating signaling pathways that activate various cellular responses, including the production of interleukin-17A/IL17A and promoting early and effective intracellular bacterial clearance. Additionally, IL-23 supports the expansion and survival of T-helper 17 cells, a CD4-positive helper T-cell subset known for producing IL-17, along with other IL-17-producing cells.

Mouse

HEK293

C-His;C-Avi

Q9EQ14 (V22-A196)

83430  [NCBI]

VPRSSSPDWAQCQQLSRNLCMLAWNAHAPAGHMNLLREEEDEETKNNVPRIQCEDGCDPQGLKDNSQFCLQRIRQGLAFYKHLLDSDIFKGEPALLPDSPMEQLHTSLLGLSQLLQPEDHPRETQQMPSLSSSQQWQRPLLRSKILRSLQAFLAIAARVFAHGAATLTEPLVPTA

23-28 kDa

Greater than 95% as determined by Tris-Bis PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Normally 8% trehalose is added as protectant before lyophilization.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.